FC875481

Overview
NameFC875481
Unique NameFC875481
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:223..925. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_LEIDO (Heat shock 70 kDa protein OS=Leishmania donovani GN=HSP70 PE=3 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 4.412e-92
Identity = 178/235 (75.74%), Postives = 195/235 (82.98%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRK-KQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+D+ VQ DMK WPFKV     DKPMI V Y+GEEK F  EEISSMVL+KM+E AEAYLG  +K AVVTVPAYFNDSQRQATKDAG IAGL V+RIINEPT  AIAYGLD K     E+NVLIFDLGGGTFDVSLLTI+ GIFEVKAT GDTHLGGEDFDNR+V  F +EFKRK K  +++ + RALR LRTA
Sbjct:   36 RTTPSYVAFTDSERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFNDSVVQSDMKHWPFKVTTKGDDKPMIAVQYRGEEKTFTPEEISSMVLLKMKETAEAYLGKQVKKAVVTVPAYFNDSQRQATKDAGTIAGLEVLRIINEPT-RAIAYGLD-KGDDGKERNVLIFDLGGGTFDVSLLTIDGGIFEVKATNGDTHLGGEDFDNRLVTFFTEEFKRKNKGKNLASSHRALRGLRTA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_CERCA (Heat shock protein 70 OS=Ceratitis capitata PE=2 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 5.763e-92
Identity = 174/235 (74.04%), Postives = 198/235 (84.26%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGR++ D  +  D+K WPFKV++    KP I V YK E KQFA EEISSMVL KM+E AE  LG+T+ +AV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAA+AYGLDK     GE+NVLIFDLGGGTFDVS+LTI+EG +FEV+ATAGDTHL GEDFDNR+V+H  +EFKRK + D+  NPRALRRLRTA
Sbjct:   33 RTTPSYVAFTDSERLIGDAAKNQVAMNPKNTVFDAKRLIGRKYDDPKIMEDVKHWPFKVVSD-GGKPKISVEYKEENKQFAPEEISSMVLTKMKETAEVILGTTVTDAVITVPAYFNDSQRQATKDAGRIAGLNVLRIINEPTAAALAYGLDKNLK--GERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHL-GEDFDNRLVSHLAEEFKRKYKKDLRSNPRALRRLRTA 263          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_PLEWA (Heat shock 70 kDa protein OS=Pleurodeles waltlii GN=HSP70 PE=2 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 9.830e-92
Identity = 171/234 (73.08%), Postives = 195/234 (83.33%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIG  AKNQV++NP NTVFDAKRLIGR+F+D  VQ DMK WPFKV++    KP + V YKG+ K F  +E+SSMVLIKM+EIAEAYLG  + NAV+TVP+Y   SQRQATKDAGV+AGLNV+ I+NEPTAAAIAY LDK     GE NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNRMVNHF + FKRK + DI+ N RA+RRLRTA
Sbjct:   38 RTTPSYVAFTDTERLIGAPAKNQVSLNPQNTVFDAKRLIGRKFNDTVVQADMKHWPFKVVSDEW-KPKVQVEYKGDNKTFFPDEVSSMVLIKMKEIAEAYLGHLVSNAVITVPSYLTASQRQATKDAGVLAGLNVLSIVNEPTAAAIAYDLDKAGR--GELNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRMVNHFHEPFKRKHKKDITKNKRAVRRLRTA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_CERAE (Heat shock 70 kDa protein 1 OS=Cercopithecus aethiops GN=HSPA1 PE=2 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 3.735e-91
Identity = 178/234 (76.07%), Postives = 196/234 (83.76%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAEA LG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPT   IAY LD+  T  GE+NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDT    EDFDNR+VNHFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVI-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEADLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPT-RTIAYALDR--TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDT-TWVEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP75_SCHPO (Heat shock protein sks2 OS=Schizosaccharomyces pombe GN=sks2 PE=1 SV=2)

HSP 1 Score: 332.028 bits (850), Expect = 1.854e-90
Identity = 170/234 (72.65%), Postives = 194/234 (82.91%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS+V FT+TERL+GDAAKNQ AMNP NTVFDAKRLIGRR+ D   Q D+K WPFKVI      P I VNY GE+KQF A+EIS+MVL KM+EI+EA L   ++ AV+TVPAYF+DSQR ATKDAG IAGLNV+RIINEPTAAAIAYGLD K+     KNVLIFDLGGGTFDVSLL I+ G+FEV ATAGDTHLGGEDFDN +V HF+QEFKRK++ DIS +PRALRRLR+A
Sbjct:   38 RTTPSFVAFTETERLVGDAAKNQAAMNPRNTVFDAKRLIGRRYEDPETQKDIKHWPFKVIDNNGI-PTIEVNYLGEKKQFTAQEISAMVLTKMKEISEAKLNKRVEKAVITVPAYFSDSQRAATKDAGAIAGLNVLRIINEPTAAAIAYGLDAKSDK--PKNVLIFDLGGGTFDVSLLKIQGGVFEVLATAGDTHLGGEDFDNALVEHFIQEFKRKQKIDISDDPRALRRLRSA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_PARLI (Heat shock 70 kDa protein II (Fragment) OS=Paracentrotus lividus GN=HSP70II PE=3 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.121e-86
Identity = 168/235 (71.49%), Postives = 194/235 (82.55%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGS-TIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKN+ A NP  ++ DAKRLIGR FSD +V+ DMK WPF VI     +P I + +KGE K F AEEISSMVL+KM+E AEAYLG  ++ +AVVTVPAYFNDSQRQATK+ GVI+G+N++RIINEPTAAAIAYGLDKK  +  E+NVLIFDL GGTFDVS+LTIEEGIFEVK+T+ DTHLGGEDFDNRMV H   EFKRK + DI+ N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNKTASNPYRSL-DAKRLIGRNFSDTNVKADMKHWPFTVIE-EGGRPKIKIEFKGESKTFYAEEISSMVLLKMKETAEAYLGKESVTDAVVTVPAYFNDSQRQATKECGVISGMNILRIINEPTAAAIAYGLDKKGGA--ERNVLIFDLVGGTFDVSVLTIEEGIFEVKSTSRDTHLGGEDFDNRMVTHSSPEFKRKHKKDITPNKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP75_ASHGO (Heat shock protein SSB OS=Ashbya gossypii GN=SSB PE=3 SV=3)

HSP 1 Score: 314.309 bits (804), Expect = 4.000e-85
Identity = 162/234 (69.23%), Postives = 186/234 (79.49%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            R TPS+V FT  ERLIGDAAKNQ A+NP NTVFDAKRLIGRRF D SVQ DMK WPFKVI      PMI V Y GE K F+ +EIS+MVL KM+EIAEA +G  ++ AV+TVPAYFND+QRQATKDAG IAGLNV+RIINEPTAAAIAYGL     S  E++VLIFDLGGGTFDVSLL I  G++ VK+T+G+THLGG+DFD  ++ HF  EFK+K   DISG+ RALRRLRTA
Sbjct:   38 RVTPSFVAFTPEERLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQSDMKTWPFKVIDANGS-PMIEVEYLGETKSFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLG-AGKSEKERHVLIFDLGGGTFDVSLLNIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKAEFKKKTGLDISGDARALRRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP75_KLULA (Heat shock protein SSB OS=Kluyveromyces lactis GN=SSB PE=3 SV=3)

HSP 1 Score: 313.538 bits (802), Expect = 6.823e-85
Identity = 163/234 (69.66%), Postives = 187/234 (79.91%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            R TPS+V FT  ERLIGDAAKNQ A+NP NTVFDAKRLIGRRF + SVQ DMK WPFKVI    D P+I V Y GE K F+ +EISSMVL KM+EIAEA +G  ++ AVVTVPAYFND+QRQATKDAG IAGLNV+RIINEPTAAAIAYGL     S  E++VLIFDLGGGTFDVSLL I  G++ VK+T+G+THLGG+DFD  ++ HF  EFK+K   DISG+ RALRRLRTA
Sbjct:   38 RVTPSFVAFTPEERLIGDAAKNQAALNPKNTVFDAKRLIGRRFDEESVQSDMKTWPFKVIDSN-DAPLIEVEYLGETKTFSPQEISSMVLTKMKEIAEAKIGKKVEKAVVTVPAYFNDAQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLG-AGKSDKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKTEFKKKTGLDISGDARALRRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_MIMIV (Heat shock 70 kDa protein homolog OS=Acanthamoeba polyphaga mimivirus GN=HSP70 PE=3 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 1.985e-84
Identity = 156/234 (66.67%), Postives = 192/234 (82.05%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FT+TE LIGDAAK Q A+NPTNT+FDAKRLIGR F+D SVQ DMK WPFKVI    +KP   V+Y+ E KQ++ E+ISSM+L KM++ A AY+G  + +AV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAA AYGLDK      E NVLIFD+GGGT DV+LL++E+G+F+V+AT+G+T LGGEDFDNR+V   V++FKRK + D++ + +ALRRLRTA
Sbjct:   36 RTTPSYVSFTETEHLIGDAAKYQAAINPTNTIFDAKRLIGRDFNDQSVQSDMKYWPFKVI-NVGNKPYFEVSYQNESKQYSPEQISSMILSKMKQTASAYIGKEVTDAVITVPAYFNDSQRQATKDAGRIAGLNVLRIINEPTAAAFAYGLDKNQDK--EMNVLIFDMGGGTHDVTLLSLEDGLFQVRATSGNTKLGGEDFDNRLVTWCVEDFKRKYKTDLNQSAKALRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP75_KLUMA (Heat shock protein SSB OS=Kluyveromyces marxianus GN=SSB PE=3 SV=2)

HSP 1 Score: 310.842 bits (795), Expect = 4.423e-84
Identity = 161/234 (68.80%), Postives = 186/234 (79.49%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            R TPS+V FT  ERLIGDAAKNQ A+NP NTVFDAKRLIGRRF + SVQ DMK WPFKVI      P+I V Y GE K F+ +EISSMVL KM+EIAEA +G  ++ AVVTVPAYFND+QRQATKDAG IAGLNV+RIINEPTAAAIAYG+     S  E++VLIFDLGGGTFDVSLL I  G++ VK+T+G+THLGG+DFD  ++ HF  EFK+K   DISG+ RALRRLRTA
Sbjct:   38 RVTPSFVAFTPEERLIGDAAKNQAALNPKNTVFDAKRLIGRRFDEESVQSDMKTWPFKVIDSNG-APLIEVEYLGETKTFSPQEISSMVLTKMKEIAEAKIGKKVEKAVVTVPAYFNDAQRQATKDAGAIAGLNVLRIINEPTAAAIAYGVG-AGNSEKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKTEFKKKTGADISGDARALRRLRTA 269          
The following BLAST results are available for this feature:
BLAST of FC875481 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP70_LEIDO4.412e-9275.74Heat shock 70 kDa protein OS=Leishmania donovani G... [more]
HSP70_CERCA5.763e-9274.04Heat shock protein 70 OS=Ceratitis capitata PE=2 S... [more]
HSP70_PLEWA9.830e-9273.08Heat shock 70 kDa protein OS=Pleurodeles waltlii G... [more]
HSP71_CERAE3.735e-9176.07Heat shock 70 kDa protein 1 OS=Cercopithecus aethi... [more]
HSP75_SCHPO1.854e-9072.65Heat shock protein sks2 OS=Schizosaccharomyces pom... [more]
HSP72_PARLI2.121e-8671.49Heat shock 70 kDa protein II (Fragment) OS=Paracen... [more]
HSP75_ASHGO4.000e-8569.23Heat shock protein SSB OS=Ashbya gossypii GN=SSB P... [more]
HSP75_KLULA6.823e-8569.66Heat shock protein SSB OS=Kluyveromyces lactis GN=... [more]
HSP70_MIMIV1.985e-8466.67Heat shock 70 kDa protein homolog OS=Acanthamoeba ... [more]
HSP75_KLUMA4.423e-8468.80Heat shock protein SSB OS=Kluyveromyces marxianus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D09EF CTVClemen1 Citrus clementina cDNA clone C31404D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875481 ID=FC875481|Name=FC875481|organism=Citrus clementina|type=EST|length=703bp
AGGACGACGCCGTCTTATGTGGGGTTCACCGACACGGAGCGTTTGATCGG
GGACGCTGCTAAGAACCAGGTCGCCATGAACCCCACGAACACCGTCTTTG
ATGCAAAGAGGTTGATTGGTAGGAGATTCAGCGATGCATCAGTCCAAGGA
GATATGAAGCTATGGCCATTTAAGGTGATTGCTGGACCAGCTGACAAGCC
CATGATTGGTGTTAACTACAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGG
AAATCTCGTCTATGGTGCTCATCAAGATGCGTGAGATTGCCGAGGCTTAC
CTTGGCTCAACTATTAAGAATGCAGTCGTTACTGTCCCTGCTTACTTCAA
TGACTCACAGAGGCAGGCCACCAAGGATGCTGGTGTCATTGCTGGGCTTA
ATGTGATGCGTATCATCAATGAGCCCACTGCTGCTGCCATTGCTTATGGC
CTTGACAAGAAGGCTACTAGTGTGGGTGAGAAGAATGTGTTGATCTTTGA
TTTGGGTGGTGGTACTTTTGATGTGTCGTTGCTCACTATTGAGGAGGGAA
TCTTTGAAGTGAAGGCTACTGCTGGAGACACTCATCTTGGTGGTGAGGAT
TTTGATAACAGAATGGTGAATCATTTTGTTCAGGAGTTTAAGAGGAAGAA
ACAGAANGATATTAGTGGCAACCCTAGAGCTCTTAGGAGATTGAGGACTG
CTT
back to top