FC875481

Overview
NameFC875481
Unique NameFC875481
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:223..925. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_CHICK (Heat shock 70 kDa protein OS=Gallus gallus PE=3 SV=1)

HSP 1 Score: 367.466 bits (942), Expect = 3.982e-101
Identity = 184/234 (78.63%), Postives = 202/234 (86.32%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNT+FDAKRLIGR++ D +VQ DMK WPF+V+     KP + V YKGE K F  EEISSMVL KM+EIAEAYLG  ++ AV+TVPAYFNDSQRQATKDAG I GLNVMRIINEPTAAAIAYGLDKK T  GEKNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVN FV+EFK K + D +GN RA+RRLRTA
Sbjct:   37 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKYDDPTVQSDMKHWPFRVV-NEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGKKVETAVITVPAYFNDSQRQATKDAGTITGLNVMRIINEPTAAAIAYGLDKKGTRAGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNRFVEEFKGKHKRDNAGNKRAVRRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS71B_PIG (Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA1B PE=2 SV=1)

HSP 1 Score: 367.466 bits (942), Expect = 3.982e-101
Identity = 187/234 (79.91%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLD+  T  GE+NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+VNHFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQADMKHWPFRVI-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGHPVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDR--TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS71B_BOVIN (Heat shock 70 kDa protein 1B OS=Bos taurus GN=HSPA1B PE=2 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 5.200e-101
Identity = 187/234 (79.91%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLD+  T  GE+NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+VNHFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVI-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDR--TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS71A_BOVIN (Heat shock 70 kDa protein 1A OS=Bos taurus GN=HSPA1A PE=2 SV=2)

HSP 1 Score: 367.081 bits (941), Expect = 5.200e-101
Identity = 187/234 (79.91%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLD+  T  GE+NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+VNHFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVI-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDR--TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_RAT (Heat shock-related 70 kDa protein 2 OS=Rattus norvegicus GN=Hspa2 PE=2 SV=2)

HSP 1 Score: 366.696 bits (940), Expect = 6.792e-101
Identity = 183/234 (78.21%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNT+FDAKRLIGR+F DA+VQ DMK WPF+V++    KP + V YKGE K F  EEISSMVL KM+EIAEAYLG  +++AV+TVPAYFNDSQRQATKDAG I GLNV+RIINEPTAAAIAYGLDKK  + GEKNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMV+H  +EFKRK + DI  N RA+RRLRTA
Sbjct:   37 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVS-EGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_CAPHI (Heat shock-related 70 kDa protein 2 OS=Capra hircus GN=HSPA2 PE=3 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 6.792e-101
Identity = 183/234 (78.21%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNT+FDAKRLIGR+F DA+VQ DMK WPF+V++    KP + V YKGE K F  EEISSMVL KM+EIAEAYLG  +++AV+TVPAYFNDSQRQATKDAG I GLNV+RIINEPTAAAIAYGLDKK  + GEKNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMV+H  +EFKRK + DI+ N RA+RRLRTA
Sbjct:   37 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVS-EGGKPKVQVEYKGEIKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIAPNKRAVRRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_ACHKL (Heat shock 70 kDa protein OS=Achlya klebsiana GN=HSP70 PE=2 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 6.792e-101
Identity = 183/234 (78.21%), Postives = 203/234 (86.75%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+D + Q D+K WPFKV  G  DKP I V +KGE K F  EEISSMVLIKM+E+AEA++G+ + NAV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPT AAIAYGLDKK    GE+NVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR+V+HF  EFKRK + D++ N RALRRLRTA
Sbjct:   38 RTTPSYVAFTDSERLIGDAAKNQVAMNPANTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSMVLIKMKEVAEAFIGTAVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTRAAIAYGLDKKG---GERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTAEFKRKHRKDMTQNQRALRRLRTA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_HUMAN (Heat shock-related 70 kDa protein 2 OS=Homo sapiens GN=HSPA2 PE=1 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 8.870e-101
Identity = 183/234 (78.21%), Postives = 203/234 (86.75%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNT+FDAKRLIGR+F DA+VQ DMK WPF+V++    KP + V YKGE K F  EEISSMVL KM+EIAEAYLG  + +AV+TVPAYFNDSQRQATKDAG I GLNV+RIINEPTAAAIAYGLDKK  + GEKNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMV+H  +EFKRK + DI  N RA+RRLRTA
Sbjct:   37 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVS-EGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTA 269          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_PONAB (Heat shock 70 kDa protein 1 OS=Pongo abelii GN=HSPA1 PE=2 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 8.870e-101
Identity = 187/234 (79.91%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLD+  T  GE+NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+VNHFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVI-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDR--TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_HUMAN (Heat shock 70 kDa protein 1A/1B OS=Homo sapiens GN=HSPA1A PE=1 SV=5)

HSP 1 Score: 366.311 bits (939), Expect = 8.870e-101
Identity = 187/234 (79.91%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLD+  T  GE+NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+VNHFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVI-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDR--TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTA 266          
The following BLAST results are available for this feature:
BLAST of FC875481 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP70_CHICK3.982e-10178.63Heat shock 70 kDa protein OS=Gallus gallus PE=3 SV... [more]
HS71B_PIG3.982e-10179.91Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA... [more]
HS71B_BOVIN5.200e-10179.91Heat shock 70 kDa protein 1B OS=Bos taurus GN=HSPA... [more]
HS71A_BOVIN5.200e-10179.91Heat shock 70 kDa protein 1A OS=Bos taurus GN=HSPA... [more]
HSP72_RAT6.792e-10178.21Heat shock-related 70 kDa protein 2 OS=Rattus norv... [more]
HSP72_CAPHI6.792e-10178.21Heat shock-related 70 kDa protein 2 OS=Capra hircu... [more]
HSP70_ACHKL6.792e-10178.21Heat shock 70 kDa protein OS=Achlya klebsiana GN=H... [more]
HSP72_HUMAN8.870e-10178.21Heat shock-related 70 kDa protein 2 OS=Homo sapien... [more]
HSP71_PONAB8.870e-10179.91Heat shock 70 kDa protein 1 OS=Pongo abelii GN=HSP... [more]
HSP71_HUMAN8.870e-10179.91Heat shock 70 kDa protein 1A/1B OS=Homo sapiens GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D09EF CTVClemen1 Citrus clementina cDNA clone C31404D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875481 ID=FC875481|Name=FC875481|organism=Citrus clementina|type=EST|length=703bp
AGGACGACGCCGTCTTATGTGGGGTTCACCGACACGGAGCGTTTGATCGG
GGACGCTGCTAAGAACCAGGTCGCCATGAACCCCACGAACACCGTCTTTG
ATGCAAAGAGGTTGATTGGTAGGAGATTCAGCGATGCATCAGTCCAAGGA
GATATGAAGCTATGGCCATTTAAGGTGATTGCTGGACCAGCTGACAAGCC
CATGATTGGTGTTAACTACAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGG
AAATCTCGTCTATGGTGCTCATCAAGATGCGTGAGATTGCCGAGGCTTAC
CTTGGCTCAACTATTAAGAATGCAGTCGTTACTGTCCCTGCTTACTTCAA
TGACTCACAGAGGCAGGCCACCAAGGATGCTGGTGTCATTGCTGGGCTTA
ATGTGATGCGTATCATCAATGAGCCCACTGCTGCTGCCATTGCTTATGGC
CTTGACAAGAAGGCTACTAGTGTGGGTGAGAAGAATGTGTTGATCTTTGA
TTTGGGTGGTGGTACTTTTGATGTGTCGTTGCTCACTATTGAGGAGGGAA
TCTTTGAAGTGAAGGCTACTGCTGGAGACACTCATCTTGGTGGTGAGGAT
TTTGATAACAGAATGGTGAATCATTTTGTTCAGGAGTTTAAGAGGAAGAA
ACAGAANGATATTAGTGGCAACCCTAGAGCTCTTAGGAGATTGAGGACTG
CTT
back to top