FC875481

Overview
NameFC875481
Unique NameFC875481
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:223..925. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_ANOAL (Heat shock protein 70 A2 OS=Anopheles albimanus GN=HSP70A2 PE=3 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 2.416e-98
Identity = 184/235 (78.30%), Postives = 202/235 (85.96%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV F+DTERLIGDAAKNQVAMNPTNTVFDAKRLIGR+F D  +Q DMK WPF V+     KP I V +KGE K FA EEISSMVL KM+E AEAYLG ++KNAV+TVPAYFNDSQRQATKDAG IAGLNVMRIINEPTAAA+AYGLDK     GE+NVLIFDLGGGTFDVS+LTI+EG +FEV+ATAGDTHLGGEDFDNRMV HFV+EFKRK + D+S N RALRRLRTA
Sbjct:   34 RTTPSYVAFSDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRKFDDPKIQADMKHWPFTVV-NDCGKPKIRVEFKGERKTFAPEEISSMVLTKMKETAEAYLGQSVKNAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLK--GERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRMVAHFVEEFKRKFKKDLSKNARALRRLRTA 265          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_ANOAL (Heat shock protein 70 A1 OS=Anopheles albimanus GN=HSP70A1 PE=3 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 2.416e-98
Identity = 184/235 (78.30%), Postives = 202/235 (85.96%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEG-IFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV F+DTERLIGDAAKNQVAMNPTNTVFDAKRLIGR+F D  +Q DMK WPF V+     KP I V +KGE K FA EEISSMVL KM+E AEAYLG ++KNAV+TVPAYFNDSQRQATKDAG IAGLNVMRIINEPTAAA+AYGLDK     GE+NVLIFDLGGGTFDVS+LTI+EG +FEV+ATAGDTHLGGEDFDNRMV HFV+EFKRK + D+S N RALRRLRTA
Sbjct:   34 RTTPSYVAFSDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRKFDDPKIQADMKHWPFTVV-NDCGKPKIRVEFKGERKTFAPEEISSMVLTKMKETAEAYLGQSVKNAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLK--GERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRMVAHFVEEFKRKFKKDLSKNARALRRLRTA 265          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS71L_HUMAN (Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2)

HSP 1 Score: 358.221 bits (918), Expect = 2.416e-98
Identity = 183/234 (78.21%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+D  VQ DMKLWPF+VI     KP + V+YKGE K F  EEISSMVL K++E AEA+LG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLDK     GE++VLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+V+HFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVI-NEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQ--GERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS7C3_DICDI (Heat shock cognate 70 kDa protein 3 OS=Dictyostelium discoideum GN=DDB_G0293674 PE=3 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 3.155e-98
Identity = 181/235 (77.02%), Postives = 200/235 (85.11%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPAD-KPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV F DTERLIGDAAKNQVAMNP NTVFDAKRLIGR+FSD+ VQ DMK WPFKVI    D KP+I V++KGE K F+ EEISSMVL KM+E AE+YLG  + NAV+TVPAYFND QRQATKDAG I+ LNV RIINEP+AAAIAYGLDKK +  GE  VLIFDLGGGTFDVSLL+I++G+FEV ATAGDTHLGGEDFDNR+VNHFV EFKRK + DI GN RALRRLRTA
Sbjct:   33 RTTPSYVAFNDTERLIGDAAKNQVAMNPINTVFDAKRLIGRKFSDSVVQSDMKHWPFKVITNKNDDKPLIQVDFKGETKTFSPEEISSMVLSKMKETAESYLGKPVNNAVITVPAYFNDGQRQATKDAGTISKLNVQRIINEPSAAAIAYGLDKKGSKSGEIKVLIFDLGGGTFDVSLLSIDDGVFEVLATAGDTHLGGEDFDNRLVNHFVDEFKRKHKKDIMGNQRALRRLRTA 267          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_PLACB (Heat shock 70 kDa protein OS=Plasmodium cynomolgi (strain Berok) PE=2 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 5.381e-98
Identity = 185/234 (79.06%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQ-XDISGNPRALRRLRT 699
            RTTPSYV FTDTERLIGDAAKNQVA NP NTVFDAKRLIGR+F+++SVQ DMK WPF V +G  +KPMI V+Y+GE+K F  EEISSMVL KM+E AEA+LG +IKNAV+TVPAYFNDSQRQATKDAG IAGLNVMRIINEPTAAAIAYGL KK    GEKN+LIFDLGGGTFDVSLLTIE+GIFEVKATAGDTHLGGEDFDNR+VN  V++FKRK +  D+S N RALRRLRT
Sbjct:   47 RTTPSYVAFTDTERLIGDAAKNQVARNPENTVFDAKRLIGRKFTESSVQSDMKHWPFTVKSGVDEKPMIEVSYQGEKKLFHPEEISSMVLQKMKENAEAFLGKSIKNAVITVPAYFNDSQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLHKKGK--GEKNILIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVNFCVEDFKRKNRGKDLSKNSRALRRLRT 278          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_PLAFA (Heat shock 70 kDa protein OS=Plasmodium falciparum PE=2 SV=2)

HSP 1 Score: 356.681 bits (914), Expect = 7.028e-98
Identity = 185/234 (79.06%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQ-XDISGNPRALRRLRT 699
            RTTPSYV FTDTERLIGDAAKNQVA NP NTVFDAKRLIGR+F+++SVQ DMK WPF V +G  +KPMI V Y+GE+K F  EEISSMVL KM+E AEA+LG +IKNAV+TVPAYFNDSQRQATKDAG IAGLNVMRIINEPTAAAIAYGL KK    GEKN+LIFDLGGGTFDVSLLTIE+GIFEVKATAGDTHLGGEDFDNR+VN  V++FKRK +  D+S N RALRRLRT
Sbjct:   47 RTTPSYVAFTDTERLIGDAAKNQVARNPENTVFDAKRLIGRKFTESSVQSDMKHWPFTVKSGVDEKPMIEVTYQGEKKLFHPEEISSMVLQKMKENAEAFLGKSIKNAVITVPAYFNDSQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLHKKGK--GEKNILIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVNFCVEDFKRKNRGKDLSKNSRALRRLRT 278          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_HYDMA (Heat shock 70 kDa protein OS=Hydra magnipapillata GN=HSP70.1 PE=3 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 7.028e-98
Identity = 182/234 (77.78%), Postives = 200/234 (85.47%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+F+D SV  D K WPF VI     +P I V +KGE K F  EEISSMVL+KM EIA+AYLG  + + V+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLDKK  +  EKNVLIFDLGGGTFDVS+L IE+GIFE+K+TAGDTHLGGEDFDNR+VNHFV EFKRK + DIS N RALRRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFNDPSVTSDRKHWPFNVI-DDGSRPKIQVEFKGETKSFYPEEISSMVLLKMEEIADAYLGKKVTDVVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKVGT--EKNVLIFDLGGGTFDVSILAIEDGIFEIKSTAGDTHLGGEDFDNRLVNHFVDEFKRKHKKDISSNKRALRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_DAUCA (Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 2.671e-97
Identity = 183/234 (78.21%), Postives = 198/234 (84.62%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSY  FTDT RLIGDA KNQVAMNP+NTVFDAKRLIGRRF+  SVQ DMKLWP +VI GP +KPMI VNYKGE KQFAAEEISSMVLIKM EIAEA+LG ++ +AVVTVPAYFNDSQRQATKD GVIAGLNVMRIINEP  A IAYGLDKK+++  E+NVLIFDLGGGTFDVSLLTIEEGI+EVKA   DTHLGGEDFDNR+VN FV EF    + DI     ALRRLRTA
Sbjct:   38 RTTPSYFAFTDTSRLIGDA-KNQVAMNPSNTVFDAKRLIGRRFNHPSVQSDMKLWPLQVIPGPGEKPMIVVNYKGESKQFAAEEISSMVLIKMLEIAEAFLGHSVNDAVVTVPAYFNDSQRQATKDTGVIAGLNVMRIINEPNCAQIAYGLDKKSSNPPEQNVLIFDLGGGTFDVSLLTIEEGIYEVKAPKSDTHLGGEDFDNRLVNRFVTEFLTNNKKDIRWECEALRRLRTA 270          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP76_SAGOE (Heat shock 70 kDa protein 6 OS=Saguinus oedipus GN=HSPA6 PE=2 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 5.950e-97
Identity = 175/234 (74.79%), Postives = 206/234 (88.03%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERL+GDAAK+Q A+NP NTVFDAKRLIGR+F+DA+VQ DMK WPF+V++    KP + V+Y+GE+K F  EEISSMVL KM+E AEAYLG  +K+AV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIA+GLD++    GE+NVLIFDLGGGTFDVS+L+I+ G+FEVKATAGDTHLGGEDFDNR+VNHFV+EF+RK + D+S N RALRRLRTA
Sbjct:   38 RTTPSYVAFTDTERLVGDAAKSQAALNPLNTVFDAKRLIGRKFADATVQADMKHWPFQVVSEGC-KPKVRVSYRGEDKSFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAHGLDRR--GAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFVEEFRRKHRKDLSWNKRALRRLRTA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP76_HUMAN (Heat shock 70 kDa protein 6 OS=Homo sapiens GN=HSPA6 PE=1 SV=2)

HSP 1 Score: 353.599 bits (906), Expect = 5.950e-97
Identity = 175/234 (74.79%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERL+GDAAK+Q A+NP NTVFDAKRLIGR+F+D +VQ DMK WPF+V++    KP + V Y+GE+K F  EEISSMVL KM+E AEAYLG  +K+AV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLD++    GE+NVLIFDLGGGTFDVS+L+I+ G+FEVKATAGDTHLGGEDFDNR+VNHF++EF+RK   D+SGN RALRRLRTA
Sbjct:   38 RTTPSYVAFTDTERLVGDAAKSQAALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVS-EGGKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRR--GAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKDLSGNKRALRRLRTA 268          
The following BLAST results are available for this feature:
BLAST of FC875481 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP72_ANOAL2.416e-9878.30Heat shock protein 70 A2 OS=Anopheles albimanus GN... [more]
HSP71_ANOAL2.416e-9878.30Heat shock protein 70 A1 OS=Anopheles albimanus GN... [more]
HS71L_HUMAN2.416e-9878.21Heat shock 70 kDa protein 1-like OS=Homo sapiens G... [more]
HS7C3_DICDI3.155e-9877.02Heat shock cognate 70 kDa protein 3 OS=Dictyosteli... [more]
HSP70_PLACB5.381e-9879.06Heat shock 70 kDa protein OS=Plasmodium cynomolgi ... [more]
HSP70_PLAFA7.028e-9879.06Heat shock 70 kDa protein OS=Plasmodium falciparum... [more]
HSP70_HYDMA7.028e-9877.78Heat shock 70 kDa protein OS=Hydra magnipapillata ... [more]
HSP70_DAUCA2.671e-9778.21Heat shock 70 kDa protein OS=Daucus carota GN=HSP7... [more]
HSP76_SAGOE5.950e-9774.79Heat shock 70 kDa protein 6 OS=Saguinus oedipus GN... [more]
HSP76_HUMAN5.950e-9774.79Heat shock 70 kDa protein 6 OS=Homo sapiens GN=HSP... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D09EF CTVClemen1 Citrus clementina cDNA clone C31404D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875481 ID=FC875481|Name=FC875481|organism=Citrus clementina|type=EST|length=703bp
AGGACGACGCCGTCTTATGTGGGGTTCACCGACACGGAGCGTTTGATCGG
GGACGCTGCTAAGAACCAGGTCGCCATGAACCCCACGAACACCGTCTTTG
ATGCAAAGAGGTTGATTGGTAGGAGATTCAGCGATGCATCAGTCCAAGGA
GATATGAAGCTATGGCCATTTAAGGTGATTGCTGGACCAGCTGACAAGCC
CATGATTGGTGTTAACTACAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGG
AAATCTCGTCTATGGTGCTCATCAAGATGCGTGAGATTGCCGAGGCTTAC
CTTGGCTCAACTATTAAGAATGCAGTCGTTACTGTCCCTGCTTACTTCAA
TGACTCACAGAGGCAGGCCACCAAGGATGCTGGTGTCATTGCTGGGCTTA
ATGTGATGCGTATCATCAATGAGCCCACTGCTGCTGCCATTGCTTATGGC
CTTGACAAGAAGGCTACTAGTGTGGGTGAGAAGAATGTGTTGATCTTTGA
TTTGGGTGGTGGTACTTTTGATGTGTCGTTGCTCACTATTGAGGAGGGAA
TCTTTGAAGTGAAGGCTACTGCTGGAGACACTCATCTTGGTGGTGAGGAT
TTTGATAACAGAATGGTGAATCATTTTGTTCAGGAGTTTAAGAGGAAGAA
ACAGAANGATATTAGTGGCAACCCTAGAGCTCTTAGGAGATTGAGGACTG
CTT
back to top