FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_SYNFM (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 97/238 (40.76%), Postives = 137/238 (57.56%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDV--FPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKKE-EVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            + IHEYQ  +L  KYG+ +P+G A  +V+E K    ++  FP    +VVK+QI AGGRG G       GGV + K   EV+  A  +LG  LVT QTGP+G++V K+ + E L +  E+Y +++ DR T+  + +    GG  IE++A K P  I+KV ID   G     A ++  GL  K          V  LYKL  + DC+L+EINPL  TS  +++A D K+NFDDNA +R K
Sbjct:    1 MKIHEYQAKQLFQKYGVPIPRGKAAFTVEEAKAVGAELGTFP----VVVKAQIHAGGRGKG-------GGVKLAKSAAEVDQYAKGILGMTLVTHQTGPEGRLVKKLLVEEGLPIEKELYLSVLPDRGTSKIVFMASEAGGMDIEEVAAKTPEKIIKVFIDPLLGFKGFHANELAYGLNLKPELIKQFNAMVAALYKLCTDYDCSLVEINPLVLTSDNRVIALDGKINFDDNAMYRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAAW (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain MW2) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 95/240 (39.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK + ++Y+ E  ++  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G++   A ++   +       N A + +  LY +F E DC+++EINPL  T+   ++A DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVY------VVKAQIHAGGRGKA-------GGVKIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQVTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKFLLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAAT (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 95/240 (39.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK + ++Y+ E  ++  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G++   A ++   +       N A + +  LY +F E DC+++EINPL  T+   ++A DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVY------VVKAQIHAGGRGKA-------GGVKIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQVTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKFLLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAAS (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain MSSA476) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 95/240 (39.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK + ++Y+ E  ++  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G++   A ++   +       N A + +  LY +F E DC+++EINPL  T+   ++A DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVY------VVKAQIHAGGRGKA-------GGVKIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQVTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKFLLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAAR (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain MRSA252) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 95/240 (39.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK + ++Y+ E  ++  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G++   A ++   +       N A + +  LY +F E DC+++EINPL  T+   ++A DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVY------VVKAQIHAGGRGKA-------GGVKITKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQVTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKFLLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAAN (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain N315) GN=sucC PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 95/240 (39.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK + ++Y+ E  ++  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G++   A ++   +       N A + +  LY +F E DC+++EINPL  T+   ++A DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVY------VVKAQIHAGGRGKA-------GGVKIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQVTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKFLLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAAM (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=sucC PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 95/240 (39.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK + ++Y+ E  ++  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G++   A ++   +       N A + +  LY +F E DC+++EINPL  T+   ++A DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVY------VVKAQIHAGGRGKA-------GGVKIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQVTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKFLLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAAE (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain Newman) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 95/240 (39.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK + ++Y+ E  ++  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G++   A ++   +       N A + +  LY +F E DC+++EINPL  T+   ++A DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVY------VVKAQIHAGGRGKA-------GGVKIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQVTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKFLLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAAC (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain COL) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 95/240 (39.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK + ++Y+ E  ++  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G++   A ++   +       N A + +  LY +F E DC+++EINPL  T+   ++A DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVY------VVKAQIHAGGRGKA-------GGVKIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQVTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKFLLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAA9 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain JH9) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 95/240 (39.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK + ++Y+ E  ++  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G++   A ++   +       N A + +  LY +F E DC+++EINPL  T+   ++A DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVY------VVKAQIHAGGRGKA-------GGVKIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQVTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKFLLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHK 227          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_SYNFM2.865e-3940.76Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAAW2.865e-3939.58Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAAT2.865e-3939.58Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAAS2.865e-3939.58Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAAR2.865e-3939.58Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAAN2.865e-3939.58Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAAM2.865e-3939.58Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAAE2.865e-3939.58Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAAC2.865e-3939.58Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAA92.865e-3939.58Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top