FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAA8 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain NCTC 8325) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 95/240 (39.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK + ++Y+ E  ++  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G++   A ++   +       N A + +  LY +F E DC+++EINPL  T+   ++A DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVY------VVKAQIHAGGRGKA-------GGVKIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQVTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKFLLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAA3 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain USA300) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 95/240 (39.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK + ++Y+ E  ++  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G++   A ++   +       N A + +  LY +F E DC+++EINPL  T+   ++A DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVY------VVKAQIHAGGRGKA-------GGVKIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQVTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKFLLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAA2 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain JH1) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 95/240 (39.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK + ++Y+ E  ++  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G++   A ++   +       N A + +  LY +F E DC+++EINPL  T+   ++A DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVY------VVKAQIHAGGRGKA-------GGVKIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQVTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKFLLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAA1 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 95/240 (39.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK + ++Y+ E  ++  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G++   A ++   +       N A + +  LY +F E DC+++EINPL  T+   ++A DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVY------VVKAQIHAGGRGKA-------GGVKIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQVTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKFLLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_POLNS (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Polynucleobacter necessarius (strain STIR1) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 94/241 (39.00%), Postives = 139/241 (57.68%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG EL+ ++ + VP G+   SVDE  KA + +       VVK+QI AGGRG G       GGV + K  +EV+  A ++LG  L T QTGP+G+ V+++ + +   +  E YF+I+ DR T   +I+  S+GG  IE++AE +P  I+KV +D   G+TD D   +  G+    A    A +  K LYK + ++D +L+EINPL      ++ A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKELLRQFNVPVPNGIPAFSVDEAVKAAEKL--GGPVWVVKAQIHAGGRGKG-------GGVKLAKSMDEVKRYASEILGMQLKTHQTGPEGQKVNRLLIEDGADIKKEYYFSIVTDRGTQKNVIMASSEGGMDIEEVAESHPEKIIKVFVDPMVGLTDADCDIIAKGIGVPEASIPMARDVFKNLYKTYWDTDASLVEINPLILEGNGKIKALDAKFNFDPNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACSU (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus subtilis GN=sucC PE=1 SV=2)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 92/236 (38.98%), Postives = 137/236 (58.05%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E++ KYG++VP+G    + +E  ++ + +       VVK+QI AGGRG         GGV I K  +EV+  A ++LG+ LVT QTGP G+++ ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A + +  LYK F E DC++ EINPL  T    ++A DAKLNFD NA +RQK
Sbjct:    1 MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVESAKSL--SSSVYVVKAQIHAGGRGKA-------GGVKIAKSLDEVKAYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYIGLVLDRATSRIVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKFMLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACCN (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus subsp. cytotoxis (strain NVH 391-98) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.865e-39
Identity = 94/239 (39.33%), Postives = 137/239 (57.32%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG  ++  YG++VP G    +V+E  +A +++  D    VVK+QI AGGRG         GGV + K  EEV   A  +LG  LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY++F E DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQGKAILRSYGVSVPNGKVAFTVEEAVEAAKELGTD--VCVVKAQIHAGGRGKA-------GGVKVAKNLEEVRTYAENILGSTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQVVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFHINIPKELVGQAVKFMMGLYRVFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_SINMW (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sinorhizobium medicae (strain WSM419) GN=sucC PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.741e-39
Identity = 98/239 (41.00%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQ   L+  YG  V +G+A+ S DE   A + +       VVKSQI AGGRG G FK   +  KGGV + K  +EV   A +MLG  LVTKQTGP GK V+++Y+ +   +  E+Y +I++DR       +  ++GG  IE +AE  P  IV V ID   G+T +D   + + L      R DA +    LYK F E D +LLE+NPL   +  ++   DAK++FD NA FR +
Sbjct:    1 MNIHEYQAKALLKSYGAPVAEGVAIFSADEAAAAAKKL--PGPLYVVKSQIHAGGRGKGKFKELGADAKGGVRLAKSADEVVAHAREMLGNTLVTKQTGPSGKQVNRLYIEDGADIDRELYLSILVDRSVGQVAFVVSTEGGMDIEAVAEHTPEKIVTVAIDPDKGVTADDLKTLTEALKLDGEARADAEKLFPILYKAFVEKDMSLLEVNPLIVMTNGRMRVLDAKVSFDGNALFRHE 237          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RALPJ (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ralstonia pickettii (strain 12J) GN=sucC PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.741e-39
Identity = 93/241 (38.59%), Postives = 139/241 (57.68%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            +NIHEYQG E++ KY + VP+G+   SVDE  KA + +       VVK+QI AGGRG G       GGV + K  E+V++ A  +LG  LVT QTGP+GK+V ++ + E   +  E+Y ++++DR +    ++  S+GG  IE++AE +P  I  + ID   G+ D  A  +   +    A    A + ++ LYK F E+D +  EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MNIHEYQGKEILRKYNVPVPRGIPAFSVDEAIKAAETL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSIEQVKEYASSILGMTLVTHQTGPEGKLVKRLLIEEGADIKKELYVSLVVDRVSQQVALMASSEGGMDIEEVAESHPEKIHTLLIDPQAGLQDAQADDIARKIGVPDASVPQARQALQGLYKAFWETDASQAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_POLSQ (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Polynucleobacter sp. (strain QLW-P1DMWA-1) GN=sucC PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.741e-39
Identity = 94/241 (39.00%), Postives = 139/241 (57.68%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG EL+ ++ + VP G+   SVDE  KA + +       VVK+QI AGGRG G       GGV + +  +EV+  A ++LG  L T QTGP+G+ V+++ + +   +  E YF+I+ DR T   +I+  S+GG  IE++AE +P  I+KV +D   G+TD D   V  G+    A    A +  K LYK + ++D +L+EINPL      ++ A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKELLRQFNVPVPNGIPAFSVDEAVKAAEKL--GGPVWVVKAQIHAGGRGKG-------GGVKLARSMDEVKKYASEILGMQLKTHQTGPEGQKVNRLLIEDGADIKKEYYFSIVTDRGTQKNVIMASSEGGMDIEEVAESHPEKIIKVFVDPMVGLTDADCDIVAKGIGVPEASIPMARDVFKNLYKTYWDTDASLVEINPLILEGNGKIKALDAKFNFDPNALFRHPEIVAY 232          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_STAA82.865e-3939.58Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAA32.865e-3939.58Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAA22.865e-3939.58Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAA12.865e-3939.58Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_POLNS2.865e-3939.00Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACSU2.865e-3938.98Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACCN2.865e-3939.33Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_SINMW3.741e-3941.00Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RALPJ3.741e-3938.59Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_POLSQ3.741e-3939.00Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top