FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_POLNA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Polaromonas naphthalenivorans (strain CJ2) GN=sucC PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.741e-39
Identity = 91/234 (38.89%), Postives = 136/234 (58.12%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + IHEYQG E++  +G+ VP+G+   +V E  +A Q +       VVK+QI AGGRG G       GGV + K  E+V+ +AG++LG  L T QTGP+G+ V ++Y+ +   +  E Y +++ DR T     I  S+GG  IE++A   P  I+   ID   G+ +E A K+ +G+         A++  +KLYK + ++D +L+EINPL   S   L+A DAK NFD NA FR
Sbjct:    1 MKIHEYQGKEILRNFGVPVPRGIPAFTVQEAVEAAQKL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKTIEDVKRIAGEILGMQLKTHQTGPEGQKVRRLYIEDGADIQKEYYVSLVTDRATQKVAFIASSEGGMDIEEVAHSTPEKIITEFIDPLTGLGEEQAVKIANGIGLPPESTAQAVDIFQKLYKCYMDTDASLVEINPLNRDSKNALMALDAKFNFDPNALFR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_MYXXD (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Myxococcus xanthus (strain DK 1622) GN=sucC PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.741e-39
Identity = 93/239 (38.91%), Postives = 137/239 (57.32%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKKE-EVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            + IHEYQG E+  KYG+  PKG+   S ++ + A +++      +VVK+QI AGGRG G       GGV + K   E ++LA +MLG  L T QTGP+G+ V KVY+ E L++  E+Y  + LDR T+    +   +GG  IE++AEK+P  I++  +D   G  D    K+  GL       N   +    LY++F ++D +L+EINPL       +VA DAK+ FD+NA +R K  L
Sbjct:    1 MKIHEYQGKEIFRKYGVPTPKGILAVSANDAEAAAKEL--GTSVVVVKAQIHAGGRGKG-------GGVKLAKSPAEAKELAKQMLGMKLKTIQTGPEGQTVHKVYIEEGLAIGQELYLGVTLDRATSRITFMASREGGVEIEEVAEKHPEKILRESVDPAVGFQDFQGRKLAFGLGLTGPTVNKFTQFCSALYRMFMDTDASLVEINPLVILKDGGVVALDAKVTFDENALYRHKDLL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_MESSB (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mesorhizobium sp. (strain BNC1) GN=sucC PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.741e-39
Identity = 97/239 (40.59%), Postives = 137/239 (57.32%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQ  EL+  YG  V +G+A+ +  E + A + +       VVKSQI AGGRG G FK      KGGV + K  EEV   A +MLG  LVTKQTGP+GK V+++Y+ +   +  E+Y +I++DR    P  +  ++GG  IE +AE+ P  I+ + I    G+T++D  K+   L    A   D       LYK F E D +LLE+NPL      +L   DAK++FD+NA FR +
Sbjct:    1 MNIHEYQAKELLRGYGAPVAQGVAIFTSGEAEAAAKKL--PGPLYVVKSQIHAGGRGKGKFKELSPDAKGGVRLAKSIEEVVANAKEMLGNTLVTKQTGPEGKQVNRLYIEDGADIARELYLSILIDRTVGRPAFVVSTEGGMDIEAVAEETPEKILTLAIAPERGVTNDDVTKLNAALKLDGAAAKDGETLFPILYKAFTEKDMSLLEVNPLIVMQNGRLRVLDAKVSFDNNALFRHE 237          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_GEOSW (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Geobacillus sp. (strain WCH70) GN=sucC PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.741e-39
Identity = 91/239 (38.08%), Postives = 140/239 (58.58%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQ  E++  YG++VP G    +V+E  +A +++       VVK+QI AGGRG         GGV + K  +EV   A ++LG++LVT QTGP+GK V ++ + E   +  E Y  +++DR T+  +++G  +GGT IE++A K P  I K  ID   G+    A ++   +       N A++ +  LY++F + DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQAKEILRNYGVSVPNGRVAFTVEEAVEAAKEL--GSPVCVVKAQIHAGGRGKA-------GGVKVAKSLDEVRTYASELLGKVLVTHQTGPEGKEVKRLLIEEGCDIKKEYYIGLVVDRATSRVVLMGSEEGGTEIEEVAAKTPEKIFKEYIDPAVGLQAFQARRLAFNINIPKELVNQAVKFMMGLYQVFVDKDCSIAEINPLVVTGDGKVMALDAKLNFDSNALYRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAES (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus epidermidis (strain ATCC 12228) GN=sucC PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.886e-39
Identity = 97/243 (39.92%), Postives = 136/243 (55.97%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK V ++Y+ E   +  E Y   ++DR T    ++   +GGT IE++A + P  I K  ID   G++   A ++   +         A + +  LY +F E DC+++EINPL  T   Q++A DAKLNFDDNA FR K  L
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVY------VVKAQIHAGGRGKA-------GGVKIAKSLSEVETYANELLGKQLVTHQTGPEGKEVKRLYIEEGCDIQKEYYVGFVIDRATDKVTLMASEEGGTEIEEVAAQTPEKIFKETIDPVVGLSPYQARRIAFNINIPKESVGKATKFLLALYNVFIEKDCSIVEINPLVTTGDGQVLALDAKLNFDDNALFRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAEQ (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=sucC PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.886e-39
Identity = 97/243 (39.92%), Postives = 136/243 (55.97%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK V ++Y+ E   +  E Y   ++DR T    ++   +GGT IE++A + P  I K  ID   G++   A ++   +         A + +  LY +F E DC+++EINPL  T   Q++A DAKLNFDDNA FR K  L
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVY------VVKAQIHAGGRGKA-------GGVKIAKSLSEVETYANELLGKQLVTHQTGPEGKEVKRLYIEEGCDIQKEYYVGFVIDRATDKVTLMASEEGGTEIEEVAAQTPEKIFKETIDPVVGLSPYQARRIAFNINIPKESVGKATKFLLALYNVFIEKDCSIVEINPLVTTGDGQVLALDAKLNFDDNALFRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_POLSJ (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=sucC PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.886e-39
Identity = 90/241 (37.34%), Postives = 140/241 (58.09%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++  +G+ VP+G+   +V E  +A Q +       VVK+QI AGGRG G       GGV + K  ++V+ +AG++LG  L T QTGP+G+ V ++Y+ +   +  E Y + + DR++     I  S+GG  IE++A   P  I+KV +D   G+TD  A +V  G+          ++ ++KLYK + E+D +L+EINPL   S  +++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRNFGVPVPRGIPAFTVQEAVEAAQKL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKTIDDVKRIAGEILGMQLKTHQTGPEGQKVRRLYIEDGADIQKEYYVSAVTDRESQKVAFIASSEGGMDIEEVAHSNPEKIIKVFVDPLVGMTDAQAKEVAAGIGMPADSVAQTVDVLQKLYKCYMETDASLVEINPLNRNSKGEIMALDAKFNFDANALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_GEOKA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Geobacillus kaustophilus GN=sucC PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.886e-39
Identity = 91/234 (38.89%), Postives = 138/234 (58.97%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++  YG++VP G    +VDE  +A +++       VVK+QI AGGRG         GGV + K  EEV   A ++LG++LVT QTGP+GK V ++ + E   +  E Y  +++DR T+  +++G  +GGT IE++A K P  I K  ID   G+    A ++   +       N A++ +  LY++F + DC++ EINPL  T   +++A DAKLNFD NA +R
Sbjct:    1 MNIHEYQAKEILRSYGVSVPNGRVAFTVDEAVEAAKEL--GAPVCVVKAQIHAGGRGKA-------GGVKVAKSLEEVRTYASELLGKVLVTHQTGPEGKEVKRLLIEEGCDIQKEYYIGLVVDRATSRVVLMGSEEGGTEIEEVAAKTPEKIFKEYIDPAVGLQAFQARRLAFNINIPKHLVNQAVKFMMGLYQVFVDKDCSIAEINPLVVTGDGKVMALDAKLNFDSNALYR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_CHLP8 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobaculum parvum (strain NCIB 8327) GN=sucC PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.886e-39
Identity = 90/236 (38.14%), Postives = 141/236 (59.75%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKE--LVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQG  ++ ++G+ VPKG+   S +E K+A  ++F +     +VVK+QI AGGRG         GGV + K  EEV ++A KMLG  LVT QTGP+GK V ++ + E +++  E Y  I LDR T+  +++  ++GG  IE +AE+ P  ++K+ ++   G+    A +    L  +     + ++ +  LYK +   D +L EINPL  T   +++A DAK+NFDDNA +R
Sbjct:    1 MNIHEYQGKGILKQFGVAVPKGIVAFSAEEAKQAAAELFEEQSSPVVVVKAQIHAGGRGKA-------GGVKLAKSPEEVYEIAQKMLGTTLVTHQTGPEGKEVRRLLIEEGMNIDKEFYLGITLDRATSCNVLMVSTEGGMEIEKVAEETPEKLLKIQVNPKYGLQGFQAREAALFLGMQGEQFRNGVKFIDALYKAYTTIDASLAEINPLVVTKEGRVLALDAKINFDDNAMYR 229          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAHJ (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus haemolyticus (strain JCSC1435) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 6.382e-39
Identity = 92/236 (38.98%), Postives = 135/236 (57.20%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP+G    + +E  +  +++  D +  VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK V ++Y+ +   +  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G++   A ++   +       N A + +  LY +F E DC+++EINPL  T   +++A DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKEL--DTEIYVVKAQIHAGGRGKA-------GGVKIAKSLSEVETYANELLGKQLVTHQTGPEGKEVKRLYIEQGCDIQKEYYVGFVIDRATDRITLMASEEGGTEIEEVAAKTPEKIFKETIDPVVGLSPYQARRIAFNINIPKESINKAAKFLISLYNVFIEKDCSIVEINPLVTTGEGEVLALDAKINFDDNALFRHK 227          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_POLNA3.741e-3938.89Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_MYXXD3.741e-3938.91Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_MESSB3.741e-3940.59Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_GEOSW3.741e-3938.08Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAES4.886e-3939.92Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAEQ4.886e-3939.92Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_POLSJ4.886e-3937.34Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_GEOKA4.886e-3938.89Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_CHLP84.886e-3938.14Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAHJ6.382e-3938.98Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top