FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_NOVAD (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Novosphingobium aromaticivorans (strain DSM 12444) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 6.382e-39
Identity = 97/241 (40.25%), Postives = 138/241 (57.26%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKK----LYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +N+HEYQ  EL+AKYG+ +P G+A  +V+E   A + +       VVK+QI AGGRG G FK   +  KGGV + K  EEVE  A +MLG  LVT QTG  GK V+++Y+ + + +  E Y ++++DR T    II  ++GG  IE++A   P  I  + ID   G        V  G A K++   D ++Q  K    LY  F   DC++LEINPL +T    L+  D K++FD NA +R
Sbjct:    1 MNVHEYQAKELLAKYGVGIPAGIAALTVEEAVAAAKQL--PGPLYVVKAQIHAGGRGKGKFKELPADAKGGVRLAKSIEEVEAFAKEMLGNTLVTVQTGEAGKQVNRLYVTDGVDIDKEYYLSMVVDRATGRVAIIVSTEGGMDIEEVAHSTPEKIATIVIDPAEGFMPHHGRAV--GFALKLS--GDLLKQAAKIAEQLYTAFVALDCSMLEINPLVQTKDGNLLVLDTKMSFDSNALYR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_CUPTR (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 6.382e-39
Identity = 94/241 (39.00%), Postives = 139/241 (57.68%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            +NIHEYQG E++ KY + VP+G+   SVDE  KA + +       VVK+QI AGGRG G       GGV + K  +EV+  A  +LG  LVT QTGP+GK V+++ + E   +  E+Y ++++DR +    ++  S+GG  IE++A   P  I  + I+   G+TD DA  +   +    A    A + ++ LYK F E+D +L EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MNIHEYQGKEILRKYNVPVPRGIPAFSVDEALKAAEQL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSMDEVKTYASNILGMQLVTHQTGPEGKKVNRLLIEEGADIKKELYVSLVVDRVSQKIALMASSEGGMDIEEVAAHTPEKIHTLIIEPSTGLTDADADDIARKIGVPDASVAQARQALQGLYKAFYETDASLAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAS1 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 8.335e-39
Identity = 91/236 (38.56%), Postives = 133/236 (56.36%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG  +    G+ VP+G    + +E  +  +++  D K  VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK + ++Y+ E   +  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G+    A ++   +       N A + +  LY +F E DC+++EINPL  T   +++A DAK+NFDDNA F+ K
Sbjct:    1 MNIHEYQGKAIFRSMGVAVPEGRVAYTAEEAVEKAKEL--DSKVYVVKAQIHAGGRGKA-------GGVKIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCDIQKEYYVGFVIDRATDRVTLMASEEGGTEIEEVAAKTPEKIFKETIDPVVGLAPYQARRIAFNINIPKESINKAAKFLVSLYNVFIEKDCSIVEINPLVTTGEGEVLALDAKVNFDDNALFKHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_NITSB (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Nitratiruptor sp. (strain SB155-2) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 8.335e-39
Identity = 92/234 (39.32%), Postives = 135/234 (57.69%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E+  +YG+ VP+G    +  E ++  Q +  D    VVK+QI AGGRG         GGV + +  +EVE +A +MLG  LVT QTGP+GK V KVY+ E   +  E Y  ++LDR +  P+++  ++GG  IE++A K P  I+KV ID   G       K+  GL     +    I+  + LYK++ + D  L+EINPL +T   + +A DAK+ FDDNA ++
Sbjct:    1 MNIHEYQAKEIFREYGVPVPRGEVAFTGPEAREVAQRLGGDL--WVVKAQIHAGGRGKA-------GGVKLARSLDEVEKIAEEMLGMTLVTHQTGPEGKKVEKVYVEEGADIQKEYYLGMVLDRSSEMPVMMASTEGGMEIEEVAAKTPEKIIKVAIDPTIGFQGFHGRKLAFGLGLAKEEIRPFIQFAEALYKVYMDKDANLIEINPLIKTGDGRFLALDAKMGFDDNALYK 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_DIAST (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Diaphorobacter sp. (strain TPSY) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 8.335e-39
Identity = 93/234 (39.74%), Postives = 137/234 (58.55%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + IHEYQG E++  +G+ VP+G+   +V E  +A Q +       VVK+QI AGGRG G       GGV + K  ++V+  A ++LG  LVT QTGP+G+ V ++Y+ +   + NE+Y +++ DR T    +I  S+GG  IE++A   P  I+   ID   GIT E + KV   +    A  + A++   KLYK + ++D +L+EINPL   S   L+A DAK NFD NA FR
Sbjct:    1 MKIHEYQGKEILRSFGVPVPRGIPAFTVQEAVEAAQKL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKTIDDVKARASEILGMQLVTHQTGPEGQKVRRLYIEDGADIKNELYVSLVTDRGTQKVALIASSEGGMDIEEVAHSTPEKIITEMIDPLTGITPEQSKKVAAAIGLTGASVDQAVDLFAKLYKCYMDTDASLVEINPLNCDSKGNLMALDAKFNFDANALFR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_CHLPD (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium phaeobacteroides (strain DSM 266) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 8.335e-39
Identity = 90/241 (37.34%), Postives = 141/241 (58.51%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKE--LVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG +++ K+G+ VPKG+   S +E K+A   +F +     +V+K+QI AGGRG         GGV + K  EEV D+A +MLG  LVT QTGP+GK V ++ + E +++  E Y  I LDR T+  +++  ++GG  IE +AE+ P  ++K+ ++   G+    A +    L  +     + ++ +  LY  +   D  + EINPL  T   +++A DAK+NFD NA FR K +L
Sbjct:    1 MNIHEYQGKDILRKFGVAVPKGIVAFSPEEAKQAAIQLFEEQNSPVVVIKAQIHAGGRGKA-------GGVKLAKSPEEVFDIAQQMLGITLVTHQTGPEGKEVRRLLVEEGMNIDKEFYVGITLDRSTSQNVLMVSTEGGMEIEKVAEETPEKLLKIQVNPLFGLQAFQARQAAFFLELEGEQFKNTVKFITALYNAYTSIDAAIAEINPLVVTKEGRVLALDAKINFDSNALFRHKDFL 234          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_ACISJ (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidovorax sp. (strain JS42) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 8.335e-39
Identity = 93/234 (39.74%), Postives = 137/234 (58.55%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + IHEYQG E++  +G+ VP+G+   +V E  +A Q +       VVK+QI AGGRG G       GGV + K  ++V+  A ++LG  LVT QTGP+G+ V ++Y+ +   + NE+Y +++ DR T    +I  S+GG  IE++A   P  I+   ID   GIT E + KV   +    A  + A++   KLYK + ++D +L+EINPL   S   L+A DAK NFD NA FR
Sbjct:    1 MKIHEYQGKEILRSFGVPVPRGIPAFTVQEAVEAAQKL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKTIDDVKARASEILGMQLVTHQTGPEGQKVRRLYIEDGADIKNELYVSLVTDRGTQKVALIASSEGGMDIEEVAHSTPEKIITEMIDPLTGITPEQSKKVAAAIGLTGASVDQAVDLFAKLYKCYMDTDASLVEINPLNCDSKGNLMALDAKFNFDANALFR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_STAAB (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.089e-38
Identity = 94/240 (39.17%), Postives = 136/240 (56.67%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKG----LAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP+G     A  +V++ K+   DV+      VVK+QI AGGRG         GGV I K   EVE  A ++LG+ LVT QTGP+GK + ++Y+ E  ++  E Y   ++DR T    ++   +GGT IE++A K P  I K  ID   G++   A ++   +       N A + +  LY +F E DC+++EINPL  T+   ++  DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKEFNSDVY------VVKAQIHAGGRGKA-------GGVKIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQVTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKFLLALYNVFIEKDCSIVEINPLVTTADGDVLVLDAKINFDDNALFRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHORT (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.089e-38
Identity = 94/237 (39.66%), Postives = 136/237 (57.38%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  +++AKYG+ V KG    + +E +K   D+       VVKSQI AGGRG G FK   +G KGGV +VK  +EV   A +MLG  LVT Q+G +GK V +VY+ +   +  E+Y ++++DR T+   ++  ++GG  IE++A   P  I    ID   GI+      V   L  +        + +  LYK F E+DC++LEINPL  T   Q++  D K+NFD NA +R
Sbjct:    1 MNIHEYQAKQVLAKYGVPVLKGGVAYTAEEAEKVALDLAGP--VYVVKSQIHAGGRGKGHFKEPSAGDKGGVRVVKSTDEVFSNAKQMLGATLVTHQSGAEGKEVKRVYIEDGCDIKRELYLSLLVDRATSAVTVMASTEGGMDIEEVANHSPEKIFFQAIDQATGISGFHCRNVAFSLGLEGKQVGAFTKLLSALYKCFTETDCSMLEINPLVVTGDGQVIPLDCKMNFDSNALYR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_GEOTN (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Geobacillus thermodenitrificans (strain NG80-2) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.089e-38
Identity = 90/234 (38.46%), Postives = 137/234 (58.55%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++  YG++VP G    +VDE  +A + +       VVK+QI AGGRG         GGV + K  EEV   A ++LG++LVT QTGP+GK V ++ + E   +  E Y  +++DR T+  +++G  +GGT IE++A K P  I K  +D   G+    A ++   +       N A++ +  LY++F + DC++ EINPL  T   +++A DAKLNFD NA +R
Sbjct:    1 MNIHEYQAKEILRSYGVSVPNGRVAFTVDEAVEAAKAL--GTSVCVVKAQIHAGGRGKA-------GGVKVAKSLEEVRTYASELLGKVLVTHQTGPEGKEVKRLLIEEGCDIQKEYYIGLVVDRATSRVVLMGSEEGGTEIEEVAAKTPEKIFKEYVDPAVGLQAFQARRLAFNINIPKKLVNQAVKFMMGLYQVFVDKDCSIAEINPLVVTGDGKVMALDAKLNFDSNALYR 225          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_NOVAD6.382e-3940.25Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_CUPTR6.382e-3939.00Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAS18.335e-3938.56Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_NITSB8.335e-3939.32Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_DIAST8.335e-3939.74Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_CHLPD8.335e-3937.34Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_ACISJ8.335e-3939.74Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_STAAB1.089e-3839.17Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RHORT1.089e-3839.66Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_GEOTN1.089e-3838.46Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top