FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACHK (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus thuringiensis subsp. konkukian GN=sucC PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.089e-38
Identity = 93/239 (38.91%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG  ++  YG++VP G    +V+E  +A +++  D    VVK+QI AGGRG         GGV + K  +EV   A  +LG  LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY+ F E DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTD--VCVVKAQIHAGGRGKA-------GGVKVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQVVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKFMMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACCZ (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain ZK / E33L) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.089e-38
Identity = 93/239 (38.91%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG  ++  YG++VP G    +V+E  +A +++  D    VVK+QI AGGRG         GGV + K  +EV   A  +LG  LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY+ F E DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTD--VCVVKAQIHAGGRGKA-------GGVKVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQVVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKFMMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACCQ (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain Q1) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.089e-38
Identity = 93/239 (38.91%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG  ++  YG++VP G    +V+E  +A +++  D    VVK+QI AGGRG         GGV + K  +EV   A  +LG  LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY+ F E DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTD--VCVVKAQIHAGGRGKA-------GGVKVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQVVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKFMMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACC7 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain AH187) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.089e-38
Identity = 93/239 (38.91%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG  ++  YG++VP G    +V+E  +A +++  D    VVK+QI AGGRG         GGV + K  +EV   A  +LG  LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY+ F E DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTD--VCVVKAQIHAGGRGKA-------GGVKVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQVVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKFMMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACC3 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain 03BB102) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.089e-38
Identity = 93/239 (38.91%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG  ++  YG++VP G    +V+E  +A +++  D    VVK+QI AGGRG         GGV + K  +EV   A  +LG  LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY+ F E DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTD--VCVVKAQIHAGGRGKA-------GGVKVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQVVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKFMMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACC1 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus cereus (strain ATCC 10987) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.089e-38
Identity = 93/239 (38.91%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG  ++  YG++VP G    +V+E  +A +++  D    VVK+QI AGGRG         GGV + K  +EV   A  +LG  LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY+ F E DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTD--VCVVKAQIHAGGRGKA-------GGVKVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQVVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKFMMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACAN (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus anthracis GN=sucC PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.089e-38
Identity = 93/239 (38.91%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG  ++  YG++VP G    +V+E  +A +++  D    VVK+QI AGGRG         GGV + K  +EV   A  +LG  LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY+ F E DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTD--VCVVKAQIHAGGRGKA-------GGVKVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQVVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKFMMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACAH (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus thuringiensis (strain Al Hakam) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.089e-38
Identity = 93/239 (38.91%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG  ++  YG++VP G    +V+E  +A +++  D    VVK+QI AGGRG         GGV + K  +EV   A  +LG  LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY+ F E DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTD--VCVVKAQIHAGGRGKA-------GGVKVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQVVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKFMMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACAC (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.089e-38
Identity = 93/239 (38.91%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG  ++  YG++VP G    +V+E  +A +++  D    VVK+QI AGGRG         GGV + K  +EV   A  +LG  LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY+ F E DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTD--VCVVKAQIHAGGRGKA-------GGVKVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQVVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKFMMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACAA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus anthracis (strain A0248) GN=sucC PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.089e-38
Identity = 93/239 (38.91%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG  ++  YG++VP G    +V+E  +A +++  D    VVK+QI AGGRG         GGV + K  +EV   A  +LG  LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LY+ F E DC++ EINPL  T   +++A DAKLNFD NA +R K  L
Sbjct:    1 MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTD--VCVVKAQIHAGGRGKA-------GGVKVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQVVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKFMMGLYRAFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDIL 230          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_BACHK1.089e-3838.91Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACCZ1.089e-3838.91Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACCQ1.089e-3838.91Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACC71.089e-3838.91Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACC31.089e-3838.91Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACC11.089e-3838.91Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACAN1.089e-3838.91Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACAH1.089e-3838.91Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACAC1.089e-3838.91Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACAA1.089e-3838.91Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top