FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_MACCJ (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Macrococcus caseolyticus (strain JCSC5402) GN=sucC PE=3 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.572e-37
Identity = 93/238 (39.08%), Postives = 135/238 (56.72%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKE--LVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG E+    G+ VP G    + +E  +  + +    KE   VVK+QI AGGRG         GGV I K  +EVE  A ++LG++LVT QTGP+GK V ++ + E   +  E Y   +LDR T   +++G  +GGT IE++AE  P  I K  ID   G+    A ++   +       N A++ +  LY +F + D +++EINPL  T   +++A DAK+NFD NA FRQK
Sbjct:    1 MNIHEYQGKEIFRSMGVAVPNGSVAYTPEEAVEVAKGL----KEGVYVVKAQIHAGGRGKA-------GGVKIAKSLDEVESYAKELLGKVLVTHQTGPEGKEVKRLLVEEGCDIKKEYYLGFVLDRATDSVVLMGSEEGGTEIEEVAEATPEKIFKEVIDPVVGLMPYQARRLAFNINIPKESVNKAVKIMLGLYDVFMKKDASIIEINPLVTTGDGEVLALDAKINFDANALFRQK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RICCN (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia conorii GN=sucC PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 2.053e-37
Identity = 92/234 (39.32%), Postives = 130/234 (55.56%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++ KYG+    GL V   +++ +    +  + +  VVK+QI AGGRG         GGV +VK KEE + +A  M G  LVT QTGPQG+ V+++Y+     ++ E YF+I+ DR  +    I  ++GG  IE +AEK P+ I+K  +D   G+ D     +   L  K        E VK +Y  F E+D T +EINPL   S   L+A DAK+ FDDN  FR
Sbjct:    1 MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINETIDKL--NTEVYVVKAQIHAGGRGKA-------GGVKVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDILKEYYFSIVFDRSASCITFIASTEGGIDIEAVAEKTPDKIIKFSVDPATGLQDFHMRGIAYELGFKDNQAKQMKEIVKSVYNAFIETDATQIEINPLIVNSDGNLLALDAKITFDDNGLFR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RALSO (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ralstonia solanacearum GN=sucC PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 2.053e-37
Identity = 91/241 (37.76%), Postives = 138/241 (57.26%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            +NIHEYQG E++ KY + VP+G+   SV+E  KA + +       VVK+QI AGGRG G       GGV + K  +EV+  A  +LG  LVT QTGP+GK V+++ + E   +  E+Y ++++DR +    ++  S+GG  IE++A   P  I  + +D   G+ D +A  +   +    A    A + ++ LYK F E+D +L EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MNIHEYQGKEILRKYNVPVPRGIPAFSVEEALKAAETL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSMDEVKTYASNILGMTLVTHQTGPEGKKVNRLLIEEGADIKKELYVSLVVDRVSQKVALMASSEGGMDIEEVAAHTPEKIHTLIVDPQIGLQDAEADDIARKIGVPDASVPQARQALQGLYKAFWETDASLAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_PERMH (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=sucC PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 2.053e-37
Identity = 95/236 (40.25%), Postives = 137/236 (58.05%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDV--FPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + +HE+Q  E+ A+YG+ VPKG    +V+E  +A Q +  FP    +VVK+QI AGGRG         GGV +    +EV+  A ++LG+ LVT QTGP+G  VS++Y+ E  ++  E Y AI LDR  +  II+  S+GG  IE++A K P  I+   ID F G+    A ++   L       N A     KLY+L+ + D +++EINPL  T    +V  DAK++FDDNA FR
Sbjct:    1 MKVHEHQAKEIFARYGLPVPKGYPAFTVEEAVEAAQQLGKFP----VVVKAQIHAGGRGKA-------GGVKLANNLDEVQKYAAELLGKTLVTFQTGPEGLPVSRIYIEEGTNIDKEFYVAITLDRSKSKLIIMASSEGGMEIEEVAAKNPEAIITEVIDPFLGLRPYQAREIALKLGLPKNLLNKAAGLFVKLYELYMKEDASMVEINPLVLTKEGNIVILDAKVDFDDNALFR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_NITHX (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=sucC PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 2.053e-37
Identity = 93/237 (39.24%), Postives = 132/237 (55.70%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+ ++G+ V +G+ V    E + A + +       VVKSQI AGGRG G FK   +G KGGV + K  +EV+  A +MLG  LVT QTGP GK V+++Y+ E   +  E Y + ++DR+T+    +  ++GG +IED+A   P  IV   +D   G+       V   L  +      A + V +LY  F   D  LLEINPL  T   +L   DAK++FDDNA +R
Sbjct:    1 MNIHEYQAKALLREFGVPVSRGVPVLKASEAEAAAETL--GGPVWVVKSQIHAGGRGKGKFKEASAGDKGGVRLAKSIDEVKQFASQMLGATLVTVQTGPAGKQVNRLYIEEGSDIDKEFYLSALVDRETSRVAFVVSTEGGVNIEDVAHTSPEKIVSFSVDPATGVMSHHGRTVAKALGLRGDLGKQAEKLVAQLYNAFIAKDMALLEINPLVVTRQGELRVLDAKVSFDDNALYR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RICM5 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia massiliae (strain Mtu5) GN=sucC PE=3 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.681e-37
Identity = 91/234 (38.89%), Postives = 129/234 (55.13%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++ KYG+    GL V   +++      +  + +  VVK+QI AGGRG         GGV +VK KEE + +A  M G  LVT QTGPQG+ V+++Y+     ++ E YF+I+ DR  +    I  ++GG  IE++AEK P  I+K  +D   G+ D     +   L  K        E VK +Y  F E+D T +EINPL   S   L+A DAK+ FDDN  F+
Sbjct:    1 MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINDTIDKL--NTEVYVVKAQIHAGGRGKA-------GGVKVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDILKEYYFSIVFDRSASCITFIASTEGGVDIEEIAEKTPEKIIKFSVDPATGLQDFHMRGIAYELGFKDNQAKQMKEIVKSVYNAFIETDATQIEINPLIVNSDGNLLALDAKITFDDNGLFQ 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RALEJ (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ralstonia eutropha (strain JMP134) GN=sucC PE=3 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.502e-37
Identity = 91/241 (37.76%), Postives = 139/241 (57.68%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            +NIHEYQG E++ KY + VP+G+   SV E  KA +++       VVK+QI AGGRG G       GGV + K  ++V+  A  +LG  LVT QTGP+GK V+++ + E   +  E+Y ++++DR +    ++  S+GG  IE++A   P  I  + I+   G+TD DA  +   +    A    A + ++ LYK F ++D +L EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MNIHEYQGKEILRKYNVPVPRGIPAFSVAEALKAAEEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSIDDVKTYATNILGMQLVTHQTGPEGKKVNRLLIEEGADIKKELYVSLVVDRVSQKIALMASSEGGMDIEEVAAHTPEKIHTLIIEPSTGLTDADADDIARKIGVPDASVAQARQALQGLYKAFYDTDASLAEINPLILTGEGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_PARL1 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=sucC PE=3 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.502e-37
Identity = 94/237 (39.66%), Postives = 138/237 (58.23%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDE-VKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQ   ++AKYG+ VP G A  + +E V KA +   P     VVK+QI AGGRG         GGV +VK  ++V+  A +++G  LVT QTGP GK V+++Y+ +  S+  E+Y +I++DR T+    I  ++GG  IE++A+K P  I+   +D  +GI+     KV   L  +       +  ++KLYK F   D ++LEINPL  T    L+  DAK+NFD NA +R K
Sbjct:    1 MNIHEYQAKAVLAKYGVPVPSGHAAFTPEEAVAKAKELGGP---VWVVKAQIHAGGRGKA-------GGVKVVKSLDDVKKEATRLIGSTLVTHQTGPDGKEVNRLYIEDGSSISRELYLSILVDRATSRVSFIVSTEGGMDIEEVAKKTPEKILSFSVDPASGISGFHGRKVAYALGLEGDQVKQGVALIEKLYKAFVTEDMSMLEINPLVVTGEGNLLCLDAKVNFDSNALYRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_NITWN (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=sucC PE=3 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.502e-37
Identity = 92/237 (38.82%), Postives = 134/237 (56.54%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+ ++G+ V +G+ V    E + A + +       VVKSQI AGGRG G FK   +G KGGV + +  +EV+  AG+MLG  LVT QTGP GK V+++Y+ E   +  E YF+ ++DR+T+    +  ++GG +IE++A K P  IV   +D   G+       V   L  +      A + V +LY  F   D  +LEINPL  T   +L   DAK++FD NA +R
Sbjct:    1 MNIHEYQAKALLREFGVPVSRGVPVLQASEAEAAAETL--GGPVWVVKSQIHAGGRGKGKFKEASAGEKGGVRLARSIDEVKTFAGQMLGATLVTAQTGPAGKQVNRLYIEEGSDIDKEFYFSALVDRETSRISFVVSTEGGMNIEEVAHKTPEKIVTFSVDPATGVMSHHGRTVARALRLRGDLGKQAEKLVTQLYDAFIARDMAMLEINPLVVTKQGELRVLDAKISFDSNALYR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_DELAS (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=sucC PE=3 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.502e-37
Identity = 88/234 (37.61%), Postives = 134/234 (57.26%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + IHEYQG +++ ++G+ VP+G+   +V E  +A Q +       VVK+QI AGGRG G       GGV + K  ++V+ LAG++LG  LVT QTGP+G+ V ++Y+ +   +  E Y + + DR T     I  S+GG  IE++A   P  I+ + +D   G+T     ++  G+          I+  +KLYK + ++D +L+EINPL   S   +VA DAK NFD NA FR
Sbjct:    1 MKIHEYQGKDILRQFGVPVPRGIPAFTVQEAVEAAQKL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSIDDVKALAGQILGMQLVTHQTGPEGQKVRRLYIEDGADIQKEYYLSCVTDRGTQKVAFIASSEGGMDIEEVAHSTPEKIITIFVDPLVGLTQAQGEELAKGIGMPADSTAQFIDICQKLYKCYMDTDASLVEINPLNRDSKGNVVALDAKFNFDANALFR 225          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_MACCJ1.572e-3739.08Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RICCN2.053e-3739.32Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RALSO2.053e-3737.76Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_PERMH2.053e-3740.25Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_NITHX2.053e-3739.24Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RICM52.681e-3738.89Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RALEJ3.502e-3737.76Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_PARL13.502e-3739.66Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_NITWN3.502e-3738.82Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_DELAS3.502e-3737.61Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top