FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_CAUSK (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Caulobacter sp. (strain K31) GN=sucC PE=3 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.502e-37
Identity = 91/237 (38.40%), Postives = 134/237 (56.54%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHE+Q   ++A++G  VP+G    +V+E   A + +       VVKSQI AGGRG G FK      KGGV +VK  E+V+  A +MLG++LVT QTGP+GK V+++Y+ E  ++  E Y ++++DR+T+   ++  ++GG  IED+A   P  I    ID   G+    A  +   L        +A   + +LY  F   D  +LEINPL  T    L   DAKL+FD NA +R
Sbjct:    1 MNIHEHQAKAVLAEFGAPVPRGYPAFTVEEAVAAAEKL--GGPVFVVKSQIHAGGRGKGKFKGLGPDAKGGVRVVKSVEDVKTNAAEMLGRVLVTHQTGPKGKQVNRLYVEEGAAIAKEFYLSLLVDRETSMVSVVASTEGGMDIEDVAHATPEKIHSFSIDPATGVWPTHARALAKALGLTGGLAKEAATLLGQLYTAFLAKDMAMLEINPLIVTEDDHLKVLDAKLSFDGNALYR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_WOLTR (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=sucC PE=3 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 4.573e-37
Identity = 92/236 (38.98%), Postives = 133/236 (56.36%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKV--VDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++ K+ + VPKG    S +E +     +  D   LVVK+QI AGGRG         GGV + K  EE +     MLG  LVT QTGP G+ V +VY+ E  S+  E Y +I++D K + P  I  S+GG  IE++A+ +P  IVK+ ID        D+ K+  +  L+P+  ++   +   K +Y  F  +D   +EINPL ET+    +A DAK++FDDNA +R
Sbjct:    1 MNIHEYQAKEILHKFNVPVPKGFVAMSAEEAETKINQLKSD--VLVVKAQIHAGGRGKA-------GGVKLAKSAEEAQQFVKGMLGITLVTHQTGPNGQQVRRVYIEEGSSIKKEYYLSIVIDPKLSRPAFIFSSEGGMDIEEVAKNFPTKIVKLDIDYAADFASFDSRKLSNIFNLSPEQIEKITNV--AKNIYDTFIATDANQIEINPLVETNSGDFIALDAKISFDDNALYR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_PHEZH (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Phenylobacterium zucineum (strain HLK1) GN=sucC PE=3 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 4.573e-37
Identity = 90/237 (37.97%), Postives = 134/237 (56.54%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHE+Q   ++A++G+ VP+G    SVDE  +A + +       VVKSQI AGGRG G F+      KGGV +VK  +EV+  A +MLG++LVT QTG  GK V+++Y+ E   +  E Y ++++DR+T+   ++  ++GG  IE++A   P  IV   ID   G+       +   L        +A   + +LY  F   D ++LEINPL  T    L   DAK++FD NA FR
Sbjct:    1 MNIHEHQAKAVLAEFGVAVPRGYPAFSVDEAVQAAEKL--GGPVFVVKSQIHAGGRGKGRFEGLGPDAKGGVRVVKSVDEVKANAEEMLGRVLVTHQTGAAGKQVNRLYIEEGAQIAKEFYLSLLVDRETSWVSVVASTEGGMDIEEVAHATPEKIVTFSIDPATGVFPHHGRHLAKALGLTGGLAKEAATLLNQLYAAFLAKDMSMLEINPLIVTGDDHLRVLDAKVSFDSNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_HYPNA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Hyphomonas neptunium (strain ATCC 15444) GN=sucC PE=3 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 4.573e-37
Identity = 96/237 (40.51%), Postives = 134/237 (56.54%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTF---KSGLKGGVHIV-KKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+  +G  V +G+ V S+ +V+KA  D  P     VVKSQI AGGRG G F   ++G KGGV +   KE+V+  A  MLG  LVT QT   GK V+++Y+ +   +  E+Y +I++DR T+    +  ++GG  IE +A   P  I+ V ID   G+T  DAAK+   L    +   D ++    LYK F E D  +LE+NPL       L   DAK++FD NA FR
Sbjct:    1 MNIHEYQAKALLKSFGAPVAEGVPVLSLADVQKAI-DTLPGPL-WVVKSQIHAGGRGKGKFIEKEAGEKGGVRLAFNKEDVKKHAEAMLGNHLVTAQTSAAGKQVNRLYIEDGADIEKELYLSILVDRATSNVAFVVSTEGGMDIEAVAHDTPEKILTVQIDPMAGVTPADAAKINSALNLSGSAAEDGLKLYPILYKAFVEKDMAMLEVNPLIVMKDGHLRVLDAKVSFDGNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_AZOSE (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Azoarcus sp. (strain EbN1) GN=sucC PE=3 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 4.573e-37
Identity = 93/241 (38.59%), Postives = 130/241 (53.94%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQ  EL+ KYG+  P+G    SVD   KA +++    K  VVK+QI AGGRG G       GGV + +  +EV   A  +LG  LVT QTGP+G+ V  + + E   +  E Y A + DR T    I+  S+GG  IE++A   P  I+K  +D   G+TD  A  +  G+    A    A++ +K+LY  + E+D +L EINPL       + A DAK NFD NA +R    + F
Sbjct:    1 MKIHEYQAKELLRKYGVVTPRGFHTVSVDGAVKAAEEL--GGKIWVVKAQIHAGGRGKG-------GGVKLARSLDEVRQHASDILGMQLVTHQTGPEGQKVRNLLIEEGADIQKEYYVAALTDRATQKVAIMASSEGGMDIEEVAHSTPEKILKEFVDPLVGLTDAQAENLARGIGVPEASVAKAVDALKRLYTCYMETDASLAEINPLILEGNGNIKALDAKFNFDSNALYRHPEIVDF 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RICAE (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia africae (strain ESF-5) GN=sucC PE=3 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.973e-37
Identity = 91/234 (38.89%), Postives = 129/234 (55.13%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++ KYG+    GL V   +++ +    +  + +  VVK+QI AGGRG         GGV +VK KEE + +A  M G  LVT QTGPQG+ V+++Y+     ++ E YF+I+ DR  +    I  ++GG  IE +AEK P+ I+K  +D   G+ D     +   L  K        E VK +Y  F E+D   +EINPL   S   L+A DAK+ FDDN  FR
Sbjct:    1 MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINETIDKL--NTEVYVVKAQIHAGGRGKA-------GGVKVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDILKEYYFSIVFDRSASCITFIASTEGGVDIEAVAEKTPDKIIKFSVDPATGLQDFHMRGIAYELGFKDNQAKQMKEIVKSVYNAFIETDAAQIEINPLIVNSDGNLLALDAKITFDDNGLFR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BRAJA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bradyrhizobium japonicum GN=sucC PE=3 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.973e-37
Identity = 94/242 (38.84%), Postives = 133/242 (54.96%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKKE-EVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQ   L+ ++G+ + KG+ V    + + A + +       VVKSQI AGGRG G FK   +G KGGV I K   EV + A +MLG  LVT QTGP GK V+++Y+ +   +  E Y ++++DR+T+    +  ++GG +IED+A   P  IV   +D   GI       V + L         A +   +LY  F   D ++LEINPL  T   QL   DAK++FDDNA FR    L
Sbjct:    1 MNIHEYQAKALLGEFGVPISKGVPVLKAADAEAAAKAL--PGPVYVVKSQIHAGGRGKGKFKEASAGDKGGVRIAKSAAEVSEFAKQMLGATLVTIQTGPAGKQVNRLYIEDGSDIDKEFYLSLLVDRETSRVSFVVSTEGGVNIEDVAHNTPEKIVTFSVDPATGIMGHHGRTVANALKLSGDLAKQAEKLTAQLYAAFVAKDMSMLEINPLVVTKQGQLRVLDAKVSFDDNALFRHPEVL 240          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RICPR (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia prowazekii GN=sucC PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 7.801e-37
Identity = 90/234 (38.46%), Postives = 128/234 (54.70%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++ KYG+    GL V   +++ +    +  + K  V+K+QI AGGRG         GGV + K KEE + +A  M G  LVT QTGPQG+ V+++Y+     ++ E YF+I+ DR  +    I  ++GG  IE +AEK P  I+K  +D   G+ D     +   L  K        E VK +Y  F E+D T +EINPL   S   L+A DAK+ FDDN  F+
Sbjct:    1 MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINETIDKL--NTKVYVIKAQIHAGGRGKA-------GGVKVAKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRIYIESGCDILKEYYFSIVFDRSASCITFIASTEGGVDIEAVAEKMPEKIIKFAVDPATGLQDFHMRGIAYELGFKDNQAKQMKEIVKAVYNAFIETDATQIEINPLIINSYGNLLALDAKITFDDNGLFK 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHOFD (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodoferax ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118) GN=sucC PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 7.801e-37
Identity = 87/241 (36.10%), Postives = 138/241 (57.26%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ + G+ VP+G+   +V E  +A Q +       VVK+QI AGGRG G       GGV + +  +EV+ LAG++LG  LVT QTGP+G+ V ++ + +   +  E Y + + DR +    +I  S+GG SIED+A   P  I+   +D   G+T   A K+ + +         A++ ++K+YK++ ++D +L+EINP+       + A DAK NFDDNA FR    + +
Sbjct:    1 MKIHEYQGKEILRQAGVPVPRGIPAFTVQEAVEAAQKL--GGPVWVVKAQIHAGGRGKG-------GGVKLARSIDEVKKLAGEILGMQLVTHQTGPEGQKVRRLLIEDGADIQKEYYVSAVTDRASQRVAMIVSSEGGMSIEDVAHDTPEKIITEIVDPATGLTVAQATKLANAIGVPAGSTAQAVDVLQKVYKVYMDTDASLVEINPMILEGNGNIKAIDAKFNFDDNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_WOLPP (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=sucC PE=3 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.019e-36
Identity = 90/234 (38.46%), Postives = 127/234 (54.27%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++ K+ + VPKG    S + V+     +  D    VVK+QI AGGRG         GGV + K  EE +     MLG  LVT QTGP G+ V ++Y+ E  S+  E Y ++++D K +  + I  S+GG  IE++A+  P  IVK  ID   G T+ D +K+ +                K +Y  F  +D + +EINPL ET+    VA DAK+NFDDNA +R
Sbjct:    1 MNIHEYQAKEILHKFNVPVPKGFVATSAEGVETQINQLKSD--VFVVKAQIHAGGRGKA-------GGVKLAKSVEEAQQFVKNMLGITLVTHQTGPSGQQVRRIYIEEGSSIKKEYYLSLVVDPKLSRLVFIFSSEGGMDIEEVAKNSPTKIVKFDIDPATGFTNLDNSKLANNFNLNSEQIERITNIAKNIYDAFITTDASQIEINPLVETNSGDFVALDAKINFDDNALYR 225          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_CAUSK3.502e-3738.40Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_WOLTR4.573e-3738.98Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_PHEZH4.573e-3737.97Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_HYPNA4.573e-3740.51Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_AZOSE4.573e-3738.59Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RICAE5.973e-3738.89Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BRAJA5.973e-3738.84Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RICPR7.801e-3738.46Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RHOFD7.801e-3736.10Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_WOLPP1.019e-3638.46Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top