FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RICRS (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia rickettsii (strain Sheila Smith) GN=sucC PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.331e-36
Identity = 90/234 (38.46%), Postives = 128/234 (54.70%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++ KYG+    GL V   +++ +    +  + +  VVK+QI AGGRG         GGV +VK KEE + +A  M G  LVT QTGPQG+ V+++Y+     ++ E YF+I+ DR  +    I  ++GG  IE++AEK P  I+K  +D   G+ D     +   L  K        E VK +Y  F E+D   +EINPL   S   L+A DAK+ FDDN   R
Sbjct:    1 MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINETIDKL--NTEVYVVKAQIHAGGRGKA-------GGVKVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCEILKEYYFSIVFDRSASCITFIASTEGGVDIEEVAEKTPEKIIKFSVDPATGLQDFHMRGIAYELGFKDNQAKQMKEIVKSVYNAFIETDAAQIEINPLIVNSDGNLLALDAKITFDDNGLLR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RICRO (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia rickettsii (strain Iowa) GN=sucC PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.331e-36
Identity = 90/234 (38.46%), Postives = 128/234 (54.70%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++ KYG+    GL V   +++ +    +  + +  VVK+QI AGGRG         GGV +VK KEE + +A  M G  LVT QTGPQG+ V+++Y+     ++ E YF+I+ DR  +    I  ++GG  IE++AEK P  I+K  +D   G+ D     +   L  K        E VK +Y  F E+D   +EINPL   S   L+A DAK+ FDDN   R
Sbjct:    1 MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINETIDKL--NTEVYVVKAQIHAGGRGKA-------GGVKVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCEILKEYYFSIVFDRSASCITFIASTEGGVDIEEVAEKTPEKIIKFSVDPATGLQDFHMRGIAYELGFKDNQAKQMKEIVKSVYNAFIETDAAQIEINPLIVNSDGNLLALDAKITFDDNGLLR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RICPU (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia peacockii (strain Rustic) GN=sucC PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.331e-36
Identity = 90/234 (38.46%), Postives = 128/234 (54.70%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++ KYG+    GL V   +++ +    +  + +  VVK+QI AGGRG         GGV +VK KEE + +A  M G  LVT QTGPQG+ V+++Y+     ++ E YF+I+ DR  +    I  ++GG  IE++AEK P  I+K  +D   G+ D     +   L  K        E VK +Y  F E+D   +EINPL   S   L+A DAK+ FDDN   R
Sbjct:    1 MNIHEYQAKEILRKYGVPTSTGLVVTQTEKINETIDKL--NTEVYVVKAQIHAGGRGKA-------GGVKVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDILKEYYFSIVFDRSASCITFIASTEGGVDIEEVAEKTPEKIIKFSVDPATGLQDFHMRGIAYELGFKDNQAKQMKEIVKSVYNAFIETDAAQIEINPLIVNSDGHLLALDAKITFDDNGLLR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RICBR (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia bellii (strain RML369-C) GN=sucC PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.331e-36
Identity = 90/234 (38.46%), Postives = 128/234 (54.70%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++ KYG+    G+ V   + +  A  ++  + K  VVK+QI AGGRG         GGV +VK KEE + +A  M G  LVT QTGPQG+ V+++Y+     ++ E YF+++ DR  +    I  ++GG  IE++AEK P  I+K  +D   G+ +  A  +   L  K        E VK  YK F E+D   +EINPL       L+A DAK  FDDN  F+
Sbjct:    1 MNIHEYQAKEILRKYGVPTSTGVVVTKTESINAAIDEL--NTKVYVVKAQIHAGGRGKA-------GGVKVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDILKEYYFSVVFDRSASCITFIASTEGGVDIEEVAEKTPEKIIKFSVDPATGLQNFHAQGIAYELGFKDHQVKQMKEIVKATYKAFIETDAAQIEINPLIVNKEGNLLALDAKFTFDDNGLFK 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_DESPS (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Desulfotalea psychrophila GN=sucC PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.331e-36
Identity = 95/236 (40.25%), Postives = 131/236 (55.51%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKKE-EVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            + IHEYQ  +L  KY I VP+GL   ++ EVK A + +      + VK+QI AGGRG G       GGV + K   EV   A  +LG  LVT QTGP G+ VSK+ L E +S+  E+Y +I++DR+ A   II C  GG +IE++A   P  I K+ I+   G       +  + L             +  LYKLF + DC+++EINPL  T   QL+A DAK++ D NA FRQ+
Sbjct:    1 MKIHEYQAKQLFRKYSIPVPEGLLCTNLQEVKTALKSL---QLPIAVKAQIHAGGRGKG-------GGVKLGKTATEVVQYADDILGMSLVTAQTGPSGRTVSKILLEEGVSIARELYLSILVDRERACITIIACQDGGMNIEEVAASTPERIGKIHINPLIGPRSYHINQAREWLNIAQEQARAFSLFIHALYKLFLDYDCSMVEINPLIITEDNQLIALDAKVDTDSNALFRQR 226          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_CAUCR (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Caulobacter crescentus GN=sucC PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.331e-36
Identity = 90/237 (37.97%), Postives = 132/237 (55.70%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHE+Q   ++A++G  VP+G A  + DE   A + +       VVKSQI AGGRG G F+      KGGV +VK  EEV   A +MLG++LVT QTGP+GK V+++Y+ E  ++  E Y ++++DR ++   ++  ++GG  IED+A   P  I    ID   G+       +   L        +A   + +LY  F   D  +LEINPL  T+   L   DAKL+FD N+ FR
Sbjct:    1 MNIHEHQAKAVLAEFGAPVPRGFAAFTPDEAAAAAEKL--GGPVFVVKSQIHAGGRGKGKFEGLGPDAKGGVRVVKSVEEVRSNAEEMLGRVLVTHQTGPKGKQVNRLYIEEGAAIAKEFYLSLLVDRASSKVSVVASTEGGMDIEDVAHSTPEKIHTFTIDPATGVWPTHHRALAKALGLTGGLAKEAASLLNQLYTAFMAKDMAMLEINPLIVTADDHLRVLDAKLSFDGNSLFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_CAUCN (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=sucC PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.331e-36
Identity = 90/237 (37.97%), Postives = 132/237 (55.70%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHE+Q   ++A++G  VP+G A  + DE   A + +       VVKSQI AGGRG G F+      KGGV +VK  EEV   A +MLG++LVT QTGP+GK V+++Y+ E  ++  E Y ++++DR ++   ++  ++GG  IED+A   P  I    ID   G+       +   L        +A   + +LY  F   D  +LEINPL  T+   L   DAKL+FD N+ FR
Sbjct:    1 MNIHEHQAKAVLAEFGAPVPRGFAAFTPDEAAAAAEKL--GGPVFVVKSQIHAGGRGKGKFEGLGPDAKGGVRVVKSVEEVRSNAEEMLGRVLVTHQTGPKGKQVNRLYIEEGAAIAKEFYLSLLVDRASSKVSVVASTEGGMDIEDVAHSTPEKIHTFTIDPATGVWPTHHRALAKALGLTGGLAKEAASLLNQLYTAFMAKDMAMLEINPLIVTADDHLRVLDAKLSFDGNSLFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: MTKA_RHILO (Probable malate--CoA ligase subunit beta OS=Rhizobium loti GN=mtkA PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.331e-36
Identity = 85/235 (36.17%), Postives = 138/235 (58.72%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHI-VKKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQ 730
            ++IHEYQ  EL+A++G++VP+G    S ++     +++     + V+K+Q+ +G RG         GG+ +    EE+   A  MLG+ LVT+QTGP+GK++S++YL E + +  E+Y   +LDRK    +I+  + GG  IED+ EK PN I++  +D   G+    A ++  GL         A E +   Y++F + D ++LEINPL  T    L+A DAK++FD+NA FR+
Sbjct:    1 MDIHEYQAKELLARHGVHVPRGGLAYSPEQATYRAREI--GGGKWVLKAQVHSGARGKA-------GGIKLCANDEEISSAAEAMLGRKLVTQQTGPRGKLISRLYLEEAVDIAQELYVGFVLDRKEERVMIVASAAGGMEIEDIVEKEPNSILRTSVDPGVGMQRFQAREIAFGLGLDHNLIGKATETIFSCYQVFRDYDASMLEINPLVVTRDGNLIALDAKMSFDENALFRR 226          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_VEREI (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Verminephrobacter eiseniae (strain EF01-2) GN=sucC PE=3 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.738e-36
Identity = 93/244 (38.11%), Postives = 139/244 (56.97%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGL---APKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG +++ ++G+ VP+G+   +V E  +A Q +       VVK+QI AGGRG G       GGV + K  +EV  LAG MLG  L T QTGP+G+ V ++Y+ E   +  E Y +I+ DR T     I  S+GG  IE++    P MI+   +D   G+  E A K+  G+   AP  A +  A++ +++LY+ + ++D +LLEINPL      +L A DAK NFD NA +R    + +
Sbjct:    1 MKIHEYQGKDILRQFGVPVPRGIPAFTVQEAVEAAQKL--GGPVWVVKAQIHAGGRGKG-------GGVQLAKTIDEVRRLAGSMLGMQLKTHQTGPEGQKVRRLYIEEGADIGKEYYLSIVTDRATQKLAFIASSEGGMDIEEVKRAKPEMIITEFVDPLAGLGPEQALKIAVGIGLPAPAQA-QAQAVDIMRRLYQCYMDTDASLLEINPLNCDGQNRLTALDAKFNFDANALWRHPEIVAY 234          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RICCK (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia canadensis (strain McKiel) GN=sucC PE=3 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.738e-36
Identity = 91/234 (38.89%), Postives = 129/234 (55.13%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++ KYGI    GL V   +++ +    +  + +  VVK+QI AGGRG         GGV +VK KEE + +A  M G  LVT QTGPQG+ V ++Y+     ++ E YF+I+ DR  +    I  + GG  IE++A+K P  IVK  +D   G+ D     +   L  K        E VK +Y  F E+D T +EINPL   +   L+A DAK+ FD+NA F+
Sbjct:    1 MNIHEYQAKEILRKYGIPTSTGLVVTKTEQINETIDKL--NTEVYVVKAQIHAGGRGKA-------GGVKVVKSKEEAKKIAHDMFGINLVTHQTGPQGQKVKRLYIESGCDILKEYYFSIVFDRSASCITFIASTAGGVDIEEVAKKTPEKIVKFSVDPATGLQDFHMRGIAYELGFKDNQVKQMKEIVKSVYNAFIETDATQIEINPLIVKTDGDLLALDAKITFDENALFK 225          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_RICRS1.331e-3638.46Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RICRO1.331e-3638.46Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RICPU1.331e-3638.46Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RICBR1.331e-3638.46Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_DESPS1.331e-3640.25Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_CAUCR1.331e-3637.97Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_CAUCN1.331e-3637.97Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
MTKA_RHILO1.331e-3636.17Probable malate--CoA ligase subunit beta OS=Rhizob... [more]
SUCC_VEREI1.738e-3638.11Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RICCK1.738e-3638.89Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top