FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHOPT (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain TIE-1) GN=sucC PE=3 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 8.625e-36
Identity = 92/237 (38.82%), Postives = 128/237 (54.01%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   ++ ++G+ V  G  +    E + A + +       VVKSQI AGGRG G FK   +G KGGV + K  +EV++ A +MLG  LVT QTG  GK V+++Y+ E   +  E Y ++++DR T+    +  ++GG SIED+A + P  IV   +D   GI       V   L  K      A   V KLY  F   D  +LEINPL  T    L   DAK++FD NA +R
Sbjct:    1 MNIHEYQAKAVLREFGVPVGHGFPIFKASEAEAAAKQL--GGPVWVVKSQIHAGGRGKGKFKEASAGDKGGVRLAKSIDEVKEFAKQMLGATLVTVQTGADGKQVNRLYIEEGSDIDKEFYLSLLVDRATSRISFVVSTEGGMSIEDVAHETPEKIVSFTVDPATGIMGHHGRTVAKALNLKGEQAKQAEAMVAKLYTAFVAKDMDMLEINPLVLTKQGDLKCLDAKISFDGNALYR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHOPA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris GN=sucC PE=3 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 8.625e-36
Identity = 92/237 (38.82%), Postives = 128/237 (54.01%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   ++ ++G+ V  G  +    E + A + +       VVKSQI AGGRG G FK   +G KGGV + K  +EV++ A +MLG  LVT QTG  GK V+++Y+ E   +  E Y ++++DR T+    +  ++GG SIED+A + P  IV   +D   GI       V   L  K      A   V KLY  F   D  +LEINPL  T    L   DAK++FD NA +R
Sbjct:    1 MNIHEYQAKAVLREFGVPVGHGFPIFKASEAEAAAKQL--GGPVWVVKSQIHAGGRGKGKFKEASAGDKGGVRLAKSIDEVKEFAKQMLGATLVTVQTGADGKQVNRLYIEEGSDIDKEFYLSLLVDRATSRISFVVSTEGGMSIEDVAHETPEKIVSFTVDPATGIMGHHGRTVAKALNLKGEQAKQAEAMVAKLYTAFVAKDMDMLEINPLVLTKQGDLKCLDAKISFDGNALYR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHOPS (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain BisB5) GN=sucC PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.126e-35
Identity = 93/237 (39.24%), Postives = 128/237 (54.01%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   ++ ++G+ V  G  +    E + A + +       VVKSQI AGGRG G FK   +G KGGV + K  +EV+D A +ML   LVT QTGP GK V+++Y+ E   +  E Y ++++DR T+    +  ++GG SIED+A   P  IV   +D   GI       V + L  K      A   V KLY  F   D  +LEINPL  T    L   DAK++FD NA +R
Sbjct:    1 MNIHEYQAKAVLREFGVPVSHGYPIFKASEAEAAAKQL--GGPVWVVKSQIHAGGRGKGKFKEASAGDKGGVRLAKSIDEVKDYAQQMLHATLVTVQTGPAGKQVNRLYVEEGSEIDKEFYLSLLVDRATSRISFVVSTEGGMSIEDVAHDTPEKIVSFTVDPATGIMAHHGRAVANTLGLKGEQAKQAESLVTKLYTAFLAKDMEMLEINPLVLTKQGDLKCLDAKMSFDGNALYR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_FLAJ1 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=sucC PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.126e-35
Identity = 90/247 (36.44%), Postives = 144/247 (58.30%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGL----AVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKL-----SLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRY 739
            +NIHEYQG E++A YG+ V +G+    AV +V   K+ T +        V+K+QI AGGRG G       GGV + K  ++VE+LA +++G  L+T QT P+GK V+KV + E +     S  +E Y +++L+R T   +I+  ++GG  IE++AE  P++I    ID   G+    A ++   L        + ++ +  LY  +  SD ++ EINP+ +TS  +++A DAK+N DDNA +RQ +Y
Sbjct:    1 MNIHEYQGKEILASYGVRVQRGIVANNAVEAVAAAKQLTAETGTGWH--VIKAQIHAGGRGKG-------GGVKLAKNLQQVEELAEQIIGMQLITPQTPPEGKKVNKVLVAEDVYYPGESETSEFYVSVLLNRGTGRNMIMYSTEGGMDIEEVAEHTPHLIFTEEIDPTVGLQGFQARRIAFNLGLSGNAFKEMVKFIDALYNAYIGSDASMFEINPVLKTSDNKILAVDAKVNIDDNALYRQPKY 238          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_CAMFF (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=sucC PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.471e-35
Identity = 92/240 (38.33%), Postives = 141/240 (58.75%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIE---QVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKR 736
            +NIHE+Q  EL+  +GINV  G+ V SVD+   A + +        VK+QI AGGRGLG       GGV I K  +EV++ A K+LG  LVTKQTGP+GK+V K+Y+ +  ++  E Y ++  DR      +I  + GG +IE++     + I+ + ID   G+ D  +  + D L     D++ +++    + KLY+L+ ++D  L+EINPL  T    L+  DAK+ FDD+A FRQ++
Sbjct:    1 MNIHEFQAKELLRDFGINVADGIMVVSVDDALNAAKKL--GGSVWAVKAQIHAGGRGLG-------GGVKIAKSLDEVKEYASKILGMTLVTKQTGPEGKLVKKLYIEKGTNIDKEYYLSLTFDRINECIAVIASADGGMNIEEVDH---DKIITIRIDPQIGLRDFHSLAIADFLN---LDKDLSVKLHVLLSKLYRLYWQTDSNLVEINPLVLTKENDLIPLDAKMGFDDSALFRQEK 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_ANAPZ (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Anaplasma phagocytophilum (strain HZ) GN=sucC PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.471e-35
Identity = 91/235 (38.72%), Postives = 129/235 (54.89%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQ 730
            +N+HE+Q   +++ + + VPKG+ V SV+EV  A   +      + VK+QI AGGRG         GGV I K +EEV DL   MLG +LVT QT   G+ V  VYL E +S+  E Y   ++DRK     +I  S+GG  IE++A   P M+V V +D   G  D    K+  GL  K           +K+ +   E+D + +EINPL ET+  + +A DAK+ FDDN  FR+
Sbjct:    1 MNVHEFQAKGILSGFDVRVPKGVVVRSVEEVDSALGSLAAGI--VAVKAQIHAGGRGKA-------GGVKIGKAREEVADLVKSMLGSVLVTHQTSAAGQKVHAVYLEEGVSIKKEYYLGAVVDRKAGMVSVIFSSEGGMDIEEVAHSRPEMVVVVNVDPVYGFLDFHGRKLCYGLGLKKEQVVQITAMARKVCRALMETDASQVEINPLVETTCGEFIALDAKMTFDDNGLFRR 226          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_ZYMMO (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Zymomonas mobilis GN=sucC PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.921e-35
Identity = 91/236 (38.56%), Postives = 130/236 (55.08%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLK--GGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NI+EYQ   L+ + G++V  G   A+V+E  KA + +       V+KSQILAGGRG G F+   K  GGV +V     V+  A  MLG+ LVT QT  QG  V K+ + E +S+  E Y ++++DR+T     +   +GG  IE +A++ P  I ++ ID   G        +   L          I+    LYK F  SD +LLEINPL ET+  +L+  DAK++FDDNA FR
Sbjct:    1 MNIYEYQAMALLNERGVSVVPGYMAANVEEAVKAAEQL--SSPPYVIKSQILAGGRGKGYFRESPKEGGGVRLVSDIAAVKKQAESMLGRHLVTAQTDDQGIPVEKLLITEAVSIAREFYLSLLVDRQTGRVTFVASPEGGMDIETVAKEKPEAIHRIAIDPATGFQPHHGRMIGFALGLSGDVFKQGIKLAASLYKAFTTSDMSLLEINPLVETNDGKLLPVDAKISFDDNALFR 234          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHOPB (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodopseudomonas palustris (strain BisB18) GN=sucC PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.509e-35
Identity = 89/237 (37.55%), Postives = 130/237 (54.85%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   ++  +G+++ KG+A+    + + A + +       VVKSQI AGGRG G FK   +G KGGV + K  EEV+  A +MLG  LVT QTGP GK V+++Y+ +   +  E Y ++++DR T+    +  ++GG +IED+A   P  I+   +D   GI       V   L         A   V +LY  F   D  +LEINPL  T   +L   DAK++FD NA +R
Sbjct:    1 MNIHEYQAKAVLQPFGVSLSKGVAILKATDAEAAAKQL--GGPIWVVKSQIHAGGRGKGKFKEASAGDKGGVRLAKSIEEVKQYAAEMLGATLVTIQTGPAGKQVNRLYIEDGSDIEKEFYLSLLVDRVTSRISFVVSTEGGMNIEDVAHDTPEKIISFSVDPATGIMGHHGRTVAKALGLTGDLAKQAERLVAQLYAAFISKDMEMLEINPLVVTKQGELKCLDAKMSFDGNALYR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHILW (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=sucC PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.509e-35
Identity = 95/237 (40.08%), Postives = 125/237 (52.74%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+  YG  V +G+A+  V+E   A + +       VVKSQI AGGRG G FK      KGGV + K  EEV   A +MLG  LVT QTG  GK V+++Y+ +   +  E+Y +I++DR       +  ++GG  IE +A   P  I  + ID   G+T  D A +   L    A   DA      LYK F E D  LLE+NPL       L   DAK++FD NA FR
Sbjct:    1 MNIHEYQAKALLKGYGAPVAEGVAILKVEEAAAAAKSL--PGPLYVVKSQIHAGGRGKGKFKELSPEAKGGVRLAKSIEEVVAHAKEMLGNTLVTAQTGDAGKQVNRLYIEDGADIARELYCSILVDRSVGRVAFVVSTEGGMDIEAVAHDTPEKIQTIAIDPEAGVTAADVAAISKALQLDGAAAEDAKSLFPALYKAFNEKDMALLEVNPLIVMKDGHLRVLDAKMSFDGNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_JANSC (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Jannaschia sp. (strain CCS1) GN=sucC PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.509e-35
Identity = 89/237 (37.55%), Postives = 131/237 (55.27%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+A+YG  V  G  V   ++ K A  ++  D    VVK+QI AGGRG G FK   +G  GGV + K  +E  D A KMLG+ LVT QTGP GK V+++Y+ +   +  EMY A+++DR+++    +  ++GG  IE++A   P  I+   +D   G       +V   L  +       ++ + +L+  F E D  +LEINPL  T    L   DAK++FD NA +R
Sbjct:    1 MNIHEYQAKALLAQYGAPVSDGRVVTKAEDAKTAAGEM--DGPLWVVKAQIHAGGRGKGKFKEADAGEAGGVRLAKSAQEAADEAKKMLGRTLVTHQTGPVGKQVNRIYIEDGSGIETEMYLALLVDRQSSRISFVCSTEGGMDIEEVAASTPEKILSFSVDPATGYQPYHGRRVAFSLGLEGQQVKQCVKLMGQLFTAFQEKDMEMLEINPLIVTDEGNLKVLDAKVSFDGNAVYR 235          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_RHOPT8.625e-3638.82Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RHOPA8.625e-3638.82Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RHOPS1.126e-3539.24Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_FLAJ11.126e-3536.44Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_CAMFF1.471e-3538.33Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_ANAPZ1.471e-3538.72Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_ZYMMO1.921e-3538.56Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RHOPB2.509e-3537.55Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RHILW2.509e-3540.08Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_JANSC2.509e-3537.55Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top