FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURP6 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia pseudomallei (strain 668) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.193e-39
Identity = 94/241 (39.00%), Postives = 140/241 (58.09%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  Q++       VVK+QI AGGRG G       GGV + K  E+V + + ++LG  L T QTGP+G+ V+++ + E   +  E+Y  I++DR +   +++  S+GG  IE++AEK P  I KV ++   G+ D +A  +   +    A    A E +K LYK F E+D +L EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAQEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSLEQVREYSNQILGMQLKTHQTGPEGQKVNRLLIEEGADIKKELYVGIVIDRVSQKVVVMASSEGGMDIEEVAEKTPEAIHKVAVEPSVGLQDAEADDLAKKIGVPDASIPQAREILKGLYKSFWETDASLAEINPLVLTGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURP1 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia pseudomallei (strain 1710b) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.193e-39
Identity = 94/241 (39.00%), Postives = 140/241 (58.09%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  Q++       VVK+QI AGGRG G       GGV + K  E+V + + ++LG  L T QTGP+G+ V+++ + E   +  E+Y  I++DR +   +++  S+GG  IE++AEK P  I KV ++   G+ D +A  +   +    A    A E +K LYK F E+D +L EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAQEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSLEQVREYSNQILGMQLKTHQTGPEGQKVNRLLIEEGADIKKELYVGIVIDRVSQKVVVMASSEGGMDIEEVAEKTPEAIHKVAVEPSVGLQDAEADDLAKKIGVPDASIPQAREILKGLYKSFWETDASLAEINPLVLTGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURP0 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia pseudomallei (strain 1106a) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.193e-39
Identity = 94/241 (39.00%), Postives = 140/241 (58.09%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  Q++       VVK+QI AGGRG G       GGV + K  E+V + + ++LG  L T QTGP+G+ V+++ + E   +  E+Y  I++DR +   +++  S+GG  IE++AEK P  I KV ++   G+ D +A  +   +    A    A E +K LYK F E+D +L EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAQEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSLEQVREYSNQILGMQLKTHQTGPEGQKVNRLLIEEGADIKKELYVGIVIDRVSQKVVVMASSEGGMDIEEVAEKTPEAIHKVAVEPSVGLQDAEADDLAKKIGVPDASIPQAREILKGLYKSFWETDASLAEINPLVLTGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURMS (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia mallei (strain SAVP1) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.193e-39
Identity = 94/241 (39.00%), Postives = 140/241 (58.09%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  Q++       VVK+QI AGGRG G       GGV + K  E+V + + ++LG  L T QTGP+G+ V+++ + E   +  E+Y  I++DR +   +++  S+GG  IE++AEK P  I KV ++   G+ D +A  +   +    A    A E +K LYK F E+D +L EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAQEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSLEQVREYSNQILGMQLKTHQTGPEGQKVNRLLIEEGADIKKELYVGIVIDRVSQKVVVMASSEGGMDIEEVAEKTPEAIHKVAVEPSVGLQDAEADDLAKKIGVPDASIPQAREILKGLYKSFWETDASLAEINPLVLTGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURMA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia mallei GN=sucC PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.193e-39
Identity = 94/241 (39.00%), Postives = 140/241 (58.09%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  Q++       VVK+QI AGGRG G       GGV + K  E+V + + ++LG  L T QTGP+G+ V+++ + E   +  E+Y  I++DR +   +++  S+GG  IE++AEK P  I KV ++   G+ D +A  +   +    A    A E +K LYK F E+D +L EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAQEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSLEQVREYSNQILGMQLKTHQTGPEGQKVNRLLIEEGADIKKELYVGIVIDRVSQKVVVMASSEGGMDIEEVAEKTPEAIHKVAVEPSVGLQDAEADDLAKKIGVPDASIPQAREILKGLYKSFWETDASLAEINPLVLTGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURM9 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia mallei (strain NCTC 10229) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.193e-39
Identity = 94/241 (39.00%), Postives = 140/241 (58.09%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  Q++       VVK+QI AGGRG G       GGV + K  E+V + + ++LG  L T QTGP+G+ V+++ + E   +  E+Y  I++DR +   +++  S+GG  IE++AEK P  I KV ++   G+ D +A  +   +    A    A E +K LYK F E+D +L EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAQEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSLEQVREYSNQILGMQLKTHQTGPEGQKVNRLLIEEGADIKKELYVGIVIDRVSQKVVVMASSEGGMDIEEVAEKTPEAIHKVAVEPSVGLQDAEADDLAKKIGVPDASIPQAREILKGLYKSFWETDASLAEINPLVLTGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURM7 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia mallei (strain NCTC 10247) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.193e-39
Identity = 94/241 (39.00%), Postives = 140/241 (58.09%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  Q++       VVK+QI AGGRG G       GGV + K  E+V + + ++LG  L T QTGP+G+ V+++ + E   +  E+Y  I++DR +   +++  S+GG  IE++AEK P  I KV ++   G+ D +A  +   +    A    A E +K LYK F E+D +L EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAQEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSLEQVREYSNQILGMQLKTHQTGPEGQKVNRLLIEEGADIKKELYVGIVIDRVSQKVVVMASSEGGMDIEEVAEKTPEAIHKVAVEPSVGLQDAEADDLAKKIGVPDASIPQAREILKGLYKSFWETDASLAEINPLVLTGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURCH (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia cenocepacia (strain HI2424) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.193e-39
Identity = 96/245 (39.18%), Postives = 145/245 (59.18%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKK----LYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  +++       VVK+QI AGGRG G       GGV + K  E+V + A ++LG  LVT QTGP+G+ V+++ + E   +  E+Y ++++DR +   +++G S+GG  IE++AEK+P +I KV ++   G+ D  A    D LA K+     +I Q +     LYK F E+D +L EINPL  +   ++ A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLMIEEGADIKQELYVSLVVDRISQKIVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQA----DDLAAKIGVPAASIPQARAILQGLYKAFWETDASLAEINPLNVSGDGKVTALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURCC (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia cenocepacia (strain MC0-3) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.193e-39
Identity = 96/245 (39.18%), Postives = 145/245 (59.18%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKK----LYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  +++       VVK+QI AGGRG G       GGV + K  E+V + A ++LG  LVT QTGP+G+ V+++ + E   +  E+Y ++++DR +   +++G S+GG  IE++AEK+P +I KV ++   G+ D  A    D LA K+     +I Q +     LYK F E+D +L EINPL  +   ++ A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLMIEEGADIKQELYVSLVVDRISQKIVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQA----DDLAAKIGVPAASIPQARAILQGLYKAFWETDASLAEINPLNVSGDGKVTALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURCA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia cenocepacia (strain AU 1054) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.193e-39
Identity = 96/245 (39.18%), Postives = 145/245 (59.18%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKK----LYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  +++       VVK+QI AGGRG G       GGV + K  E+V + A ++LG  LVT QTGP+G+ V+++ + E   +  E+Y ++++DR +   +++G S+GG  IE++AEK+P +I KV ++   G+ D  A    D LA K+     +I Q +     LYK F E+D +L EINPL  +   ++ A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLMIEEGADIKQELYVSLVVDRISQKIVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQA----DDLAAKIGVPAASIPQARAILQGLYKAFWETDASLAEINPLNVSGDGKVTALDAKFNFDSNALFRHPEIVAY 232          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_BURP62.193e-3939.00Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURP12.193e-3939.00Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURP02.193e-3939.00Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURMS2.193e-3939.00Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURMA2.193e-3939.00Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURM92.193e-3939.00Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURM72.193e-3939.00Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURCH2.193e-3939.18Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURCC2.193e-3939.18Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURCA2.193e-3939.18Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top