FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB2_MOUSE (Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Mus musculus GN=Suclg2 PE=2 SV=3)

HSP 1 Score: 201.83 bits (512), Expect = 3.262e-51
Identity = 107/238 (44.96%), Postives = 152/238 (63.87%), Query Frame = 2
Query:   23 RRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKKEEVE-DLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            R LN+ EYQ  +LM+++G+ V +     +  E  +A + +  + KE+V+K+QILAGGRG G F SGLKGGVH+ K  +V  +LA +M+G  L TKQT  +G  V+KV + E L +  E Y AI++DR   GP+I+G  +GG  IE++A   P +I K  ID+F GI D  A ++ + L    + +N A +Q+ KLY LF + D T +E+NP  ET   Q+V  DAK+NFDDNA FRQK
Sbjct:   37 RWLNLQEYQSKKLMSEHGVRVQRFFVANTAKEALEAAKRL--NAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPKVVGELAQQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSHNGPVIVGSPQGGVDIEEVAASSPELIFKEQIDIFEGIKDSQAQRMAENLGFLGSLKNQAADQITKLYHLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQK 272          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_AKKM8 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Akkermansia muciniphila (strain ATCC BAA-835) GN=sucC PE=3 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 7.268e-51
Identity = 105/234 (44.87%), Postives = 149/234 (63.68%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  +L  ++G+  PKG+A ++  E  +  +++     + VVK+Q+ AGGRG GTFK+G KGGVH+VK  EEVE++AGKML Q+LVTKQTG  GK+VSK+ + E + L  E YFAI+ DR    P+I+  ++GG  IE++A   P  I++  I+   GI    A K+   L         A + +  +YKLF   DC+L+EINPL  T+  ++ A DAK NFDDNA +R
Sbjct:    1 MNIHEYQAKQLFERFGVATPKGIAASTAQEAAQTARNM--GLSQYVVKAQVHAGGRGKGTFKNGFKGGVHVVKSVEEVEEVAGKMLNQVLVTKQTGEAGKLVSKIMVAEAVDLKKECYFAILQDRARECPVIVASTEGGMDIEEVAATRPEAIIREHINPALGILPFQALKIAVALELTGPLLRQATKLITNVYKLFTALDCSLVEINPLVVTTDDRVCALDAKFNFDDNALYR 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB2_PIG (Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial (Fragment) OS=Sus scrofa GN=SUCLG2 PE=1 SV=2)

HSP 1 Score: 199.904 bits (507), Expect = 1.240e-50
Identity = 107/238 (44.96%), Postives = 149/238 (62.61%), Query Frame = 2
Query:   23 RRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKKEEVE-DLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            R LN+ EYQ  +LM+  G+ V +     + +E  +A + +  + KE+V+K+QILAGGRG G F SGLKGGVH+ K  EV   LA +M+G  L TKQT  +G  V+KV + E L +  E Y AI++DR   GP+++G  +GG  IE++A   P +I K  ID+  GI D  A ++ + L      +N A +Q+KKLY LF + D T +E+NP  ET   Q+V  DAK+NFDDNA FRQK
Sbjct:   37 RWLNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRL--NAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPEVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLQNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQK 272          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB2_BOVIN (Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Bos taurus GN=SUCLG2 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 3.607e-50
Identity = 106/238 (44.54%), Postives = 148/238 (62.18%), Query Frame = 2
Query:   23 RRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKKEEVE-DLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            R LN+ EYQ  +LM+  G+ V +     + +E  +A + +  + KE+V+K+QILAGGRG G F SGLKGGVH+ K  +V   LA +M+G  L TKQT  +G  V KV + E L +  E Y AI++DR   GP+++G  +GG  IE++A   P +I K  ID+  GI D  A ++ + L      +N A +Q+KKLY LF + D T +E+NP  ET   Q+V  DAK+NFDDNA FRQK
Sbjct:   36 RWLNLQEYQSKKLMSDNGVKVQRFFVADTANEALEAAKRL--NAKEIVLKAQILAGGRGKGVFSSGLKGGVHLTKDPKVVGQLAKQMIGYNLATKQTPKEGVKVKKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIIEGIKDSQAQRMAENLGFLGPLKNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQK 271          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB2_HUMAN (Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Homo sapiens GN=SUCLG2 PE=1 SV=2)

HSP 1 Score: 196.438 bits (498), Expect = 1.371e-49
Identity = 105/238 (44.12%), Postives = 148/238 (62.18%), Query Frame = 2
Query:   23 RRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKKEEVE-DLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            R LN+ EYQ  +LM+  G+ V +     + +E  +A + +  + KE+V+K+QILAGGRG G F SGLKGGVH+ K   V   LA +M+G  L TKQT  +G  V+KV + E L +  E Y AI++DR   GP+++G  +GG  IE++A   P +I K  ID+F GI D  A ++ + L      ++ A +Q+ KLY LF + D T +E+NP  ET   Q+V  DAK+NFDDNA FRQK
Sbjct:   36 RWLNLQEYQSKKLMSDNGVRVQRFFVADTANEALEAAKRL--NAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQK 271          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB_NEOFR (Succinyl-CoA ligase [GDP-forming] subunit beta, hydrogenosomal OS=Neocallimastix frontalis GN=SCSB PE=2 SV=2)

HSP 1 Score: 194.512 bits (493), Expect = 5.208e-49
Identity = 105/246 (42.68%), Postives = 156/246 (63.41%), Query Frame = 2
Query:    8 QQQQLRRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIV-KKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDE---DAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            Q  Q R L++HEY    L+ +Y +N PKG+   + +E  +A + +  + ++LV+K+Q+LAGGRG G F SGL+GGV +    E+V+D A KMLG  L+TKQTG  G+  + VY+ E+     E YFAI+LDR T GP+++  S+GG  IE++A+  P+ I+ VP  +  G+T E   D AK + G   K   +  A +   KLYK+F E D T++EINP+AE +  ++V  DAK  FDDNA+++ K
Sbjct:   21 QTAQKRFLSVHEYCSMNLLHEYNVNAPKGIVAKTPEEAYQAAKKL--NTEDLVIKAQVLAGGRGKGHFDSGLQGGVKLCYTPEQVKDYASKMLGHKLITKQTGAAGRDCNAVYVVERQYAAREYYFAILLDRATRGPVLVASSEGGVEIEEVAKTNPDAILTVPFSIKTGLTREVALDTAKKM-GFTEKCVPQ--AADTFMKLYKIFIEKDATMVEINPMAENNRGEVVCMDAKFGFDDNASYKPK 261          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB_SCHPO (Probable succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Schizosaccharomyces pombe GN=SPCC1620.08 PE=2 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 5.759e-48
Identity = 100/238 (42.02%), Postives = 151/238 (63.45%), Query Frame = 2
Query:   17 QLRRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVH-IVKKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            Q R L +HEY   +++ K+G++VP+G    S +E +K  +D+     +LVVK+Q+LAGGRG G F SGL+GGV  +    E    A +M+G  L+T+QTGP GKI + VY+CE+  +  E YFAI++DR+   P+I+   +GG  IE +A + P+ I+K  +     +    A ++VD L    + +  A++ + KLYK+F + D T +EINPLAET+  +++  DAKLNFDDNA FR
Sbjct:   19 QKRNLALHEYISHDILRKFGVDVPRGAPARSGEEAEKVARDL--KVTDLVVKAQVLAGGRGKGQFDSGLRGGVRPVYDATEARMFAEQMIGHKLITRQTGPAGKICNVVYVCERKFIRKEYYFAILMDRENQCPMIVASDQGGVDIETVAAENPSAIIKRSLPNSPNLDPHIAEELVDKLGFSSSSKPKAVDAIVKLYKVFNDCDATQVEINPLAETTDHKVLCMDAKLNFDDNAEFR 254          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_MAGSA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=sucC PE=3 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 2.858e-47
Identity = 103/238 (43.28%), Postives = 146/238 (61.34%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGL--KGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQG +++AKYG+ V KG    + DE  +  +D+       VVKSQI AGGRG G FK+    KGGV + K  EEV+    +MLGQ+L+TKQTGP GK V +VY+ +   +  E+Y ++++DR T    I+  ++GG  IE++A  +P  I+KV ID   G       ++  GL  +    N  ++ V  LYK F + DC+++EINPL  T   +L+A DAK+NFDDNA FR K
Sbjct:    1 MNIHEYQGKQVLAKYGVAVLKGGVAYTPDEAVQVAKDL--GGPVWVVKSQIHAGGRGAGRFKNDPNGKGGVRVAKSVEEVKTNVDQMLGQVLITKQTGPAGKEVKRVYIEQGCDIKRELYLSMLVDRATCRVTIVASTEGGMEIEEVAHNHPEKILKVAIDPVEGFQQYHGRQIAFGLGLEGKQVNTCVKFVGALYKAFMDLDCSIVEINPLVVTGAGELIALDAKVNFDDNALFRHK 236          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB_YEAST (Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Saccharomyces cerevisiae GN=LSC2 PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.852e-46
Identity = 99/245 (40.41%), Postives = 156/245 (63.67%), Query Frame = 2
Query:   14 QQLRRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETS---GKQLVAADAKLNFDDNAAFRQKR 736
            Q  R L+IHEY+ A+L+ +YGI  P+G    + +E  +A + +  +  +LV+K+Q L GGRG G F +G K GVH+++  ++ ED+A +ML   L+TKQTG  GK VS VY+ +++   +E Y +I++DR+T  P+II  S+GG +IE++AE+ P+ I K  I+   G++ + A  V   L      +++A + V  LYK+F E D T +EINPL+E       +++  DAK  FDDNA+FRQ++
Sbjct:   26 QARRHLSIHEYRSAQLLREYGIGTPEGFPAFTPEEAFEAAKKL--NTNKLVIKAQALTGGRGKGHFDTGYKSGVHMIESPQQAEDVAKEMLNHNLITKQTGIAGKPVSAVYIVKRVDTKHEAYLSILMDRQTKKPMIIASSQGGMNIEEVAERTPDAIKKFSIETSKGLSPQMAKDVAKSLGFSPDAQDEAAKAVSNLYKIFMERDATQVEINPLSEIEHDPTHKIMCTDAKFGFDDNASFRQEK 268          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_OPITP (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=sucC PE=3 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 3.494e-45
Identity = 101/234 (43.16%), Postives = 138/234 (58.97%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L  K+G+ VPKG    + +E   A   +      +VVKSQI AGGRG GTF  G KGGV + K K E  + AGKMLG  LVT QTGP G+ V  +Y      +  E Y AI+LDR T+ P+I+  ++GG  IE +A   P+ I KV +D   G+ D    ++V  L    A+  +A + ++ LY+ F E+D +++E+NPL  T   Q+ A DAK+ FDDNA FR
Sbjct:    1 MNIHEYQAKALFEKFGVLVPKGAPAKTPEEFVTALAQL--PEGMIVVKSQIHAGGRGKGTFTDGFKGGVKVCKSKAEAREAAGKMLGNTLVTAQTGPAGRKVQTIYFNVGSQIKKEYYLAILLDRATSRPVIVASTEGGMEIEKVAHDTPDRIFKVHVDPAYGLADFQVRELVFKLGFTAAEGKNASKLIRALYRCFWENDASMVEVNPLITTPDGQVEALDAKVAFDDNALFR 232          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCB2_MOUSE3.262e-5144.96Succinyl-CoA ligase [GDP-forming] subunit beta, mi... [more]
SUCC_AKKM87.268e-5144.87Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCB2_PIG1.240e-5044.96Succinyl-CoA ligase [GDP-forming] subunit beta, mi... [more]
SUCB2_BOVIN3.607e-5044.54Succinyl-CoA ligase [GDP-forming] subunit beta, mi... [more]
SUCB2_HUMAN1.371e-4944.12Succinyl-CoA ligase [GDP-forming] subunit beta, mi... [more]
SUCB_NEOFR5.208e-4942.68Succinyl-CoA ligase [GDP-forming] subunit beta, hy... [more]
SUCB_SCHPO5.759e-4842.02Probable succinyl-CoA ligase [GDP-forming] subunit... [more]
SUCC_MAGSA2.858e-4743.28Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCB_YEAST1.852e-4640.41Succinyl-CoA ligase [ADP-forming] subunit beta, mi... [more]
SUCC_OPITP3.494e-4543.16Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top