FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_DESAA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Desulfatibacillum alkenivorans (strain AK-01) GN=sucC PE=3 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.734e-44
Identity = 103/238 (43.28%), Postives = 147/238 (61.76%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDV--FPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            + IHEYQ  EL A YG+ VPKG  V SVDE  +A +++  FP    +VVK+QI AGGRG G       GGV + +  +EV+ +AG++LG  LVT QTGP+G+ V K+ + + L +  E+YF+I++DR TA  +I+    GG  IE++A   P  I+KVP+D   G+      +    L    A     I+ V+ LYK+F ++DC+LLEINPL  T    ++A DAK+NFDD+A +R K
Sbjct:    1 MKIHEYQAKELFANYGVPVPKGKPVFSVDEAVEAAKELGDFP----VVVKAQIHAGGRGKG-------GGVKLAQNIDEVKTIAGEILGMQLVTHQTGPEGQKVQKLLVEQGLDIAKELYFSIIVDRATAKIVIMCSEAGGMDIEEVAASTPEKIIKVPVDPLLGVQGYHCRQAAYRLNLPPAAIKPFIKMVQGLYKMFMDTDCSLLEINPLVLTGDDGIIALDAKINFDDSALYRHK 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB1_CAEEL (Probable succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Caenorhabditis elegans GN=F47B10.1 PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 6.589e-44
Identity = 105/240 (43.75%), Postives = 146/240 (60.83%), Query Frame = 2
Query:   23 RRLNIHEYQGAELMAKYGINVPK-GLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIV-KKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKR 736
            R L +HE+ G +++  Y I VP  G+A  +     +A +      K+ VVK+Q+LAGGRG G F SGL+GGV IV   +EV+  AG M+G  L+TKQT  +GK   +V +C++L    E YF+I LDR T GPI+I  S+GG +IE++A   P+ IVK+PIDV  GIT E A ++   +         A E ++KLY++F  SD TL+EINP+AE     +   D KL  D NA FRQ +
Sbjct:   22 RTLMLHEHHGMKILQNYEIKVPPFGVAQDAETAFSEAKRI---GGKDYVVKAQVLAGGRGKGRFSSGLQGGVQIVFTPDEVKQKAGMMIGANLITKQTDHRGKKCEEVMVCKRLFTRREYYFSITLDRNTNGPIVIASSQGGVNIEEVAATNPDAIVKMPIDVNVGITKELAHEIAVKMGFSKDCEQQASEIIEKLYQMFKGSDATLVEINPMAEDVNGDVYCMDCKLLLDSNAEFRQAK 258          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB2_CAEEL (Probable succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Caenorhabditis elegans GN=C50F7.4 PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 8.605e-44
Identity = 100/251 (39.84%), Postives = 152/251 (60.56%), Query Frame = 2
Query:   11 QQQLRRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKG--GVHIVKKEEVE-DLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLFVT 754
            + Q R LN+ E+Q  E++ K+G +V   +  ++  E ++     F DH E VVK+QILAGGRG G F +G KG  GV I K+++   +   +M+G+ LVTKQT  +G  V KV + E + +  E Y A+++DR++ GP+++    GG  IE +AEK P  I K PID+  G+T+  + K+   L  +      A +++K+LY LF   D T +EINPL ET+  ++   DAK+NFDD+AA+RQK    + T
Sbjct:   14 KSQRRFLNLQEFQSKEILEKHGCSVQNFVVASNRKEAEEKWMS-FGDH-EYVVKAQILAGGRGKGKFINGTKGIGGVFITKEKDAALEAIDEMIGKRLVTKQTTSEGVRVDKVMIAEGVDIKRETYLAVLMDRESNGPVVVASPDGGMDIEAVAEKTPERIFKTPIDIQMGMTEGQSLKIAKDLQFEGKLIGVAAQEIKRLYDLFIAVDATQVEINPLVETADGRVFCVDAKMNFDDSAAYRQKEIFAYET 262          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_CHLCH (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium chlorochromatii (strain CaD3) GN=sucC PE=3 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.124e-43
Identity = 94/241 (39.00%), Postives = 146/241 (60.58%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPD--HKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG +++ K+G+ VPKG+   S DE K+A + +F +     +VVK+QI AGGRG         GGV + K  EE  ++A +M+G  L+T QTGP+GK+VS++ + E + +  E Y  I LDR T+  +++  ++GG  IE +AE+ P  ++K+ ID   G+    A +    L  +     +A+  +  LYK +   D ++ EINPL  TS  +++A DAK+NFDDNA +R K Y+
Sbjct:    1 MNIHEYQGKDILRKFGVTVPKGIVAYSADEAKQAAEQLFAETGSSVVVVKAQIHAGGRGKA-------GGVKLAKSPEEAFEIARQMIGMTLITHQTGPEGKVVSRLLIEEGMGIEKEFYVGITLDRATSRNVLMVSTEGGMEIETVAEETPEKLLKIQIDPLFGMQGFQAREAAFFLGLEGEQFRNAVNFITALYKAYTSIDASVAEINPLVVTSEGKVIALDAKINFDDNALYRHKEYM 234          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_OCHA4 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=sucC PE=3 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.468e-43
Identity = 103/237 (43.46%), Postives = 143/237 (60.34%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+  YG  +  G+AV SV++ ++  + +       VVKSQI AGGRG G FK   +  KGGV + K  EEV   A +MLG  LVTKQTGP GK V+++Y+ +   +  E+Y +I++DR    P  +  ++GG  IE +AE+ P  IV V ID   G+TDEDA+K+ D L  +   R D ++    LYK F E D +LLEINPL   +  ++   DAK++FD NA FR
Sbjct:    1 MNIHEYQAKRLLHTYGAPIANGVAVYSVEQAEEWAKTL--PGPLYVVKSQIHAGGRGKGKFKELPADAKGGVRLAKSVEEVVANAKEMLGNTLVTKQTGPAGKQVNRLYIEDGADIDRELYLSILIDRTVGRPAFVVSTEGGMDIEAVAEETPEKIVTVAIDPAKGVTDEDASKLADALKLEGQAREDGVKLFPILYKAFTEKDMSLLEINPLIVMTDGRVRVLDAKVSFDGNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACP2 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus pumilus (strain SAFR-032) GN=sucC PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 3.270e-43
Identity = 99/239 (41.42%), Postives = 144/239 (60.25%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG E++ KYG++VP G    + DE  KA++++  +    VVK+QI AGGRG         GGV I K K+EV+  A ++LG+ LVT QTGP+G+ + ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  IVKV ID   G+    A +V   +         A++ +  LY  F E DC++ EINPL  T   +++A DAKLNFD NA +RQK  L
Sbjct:    1 MNIHEYQGKEILRKYGVSVPNGKVAFTPDEAVKASEEL--ESSVYVVKAQIHAGGRGKA-------GGVKIAKTKDEVKGFAEELLGKTLVTHQTGPEGREIKRLLIEEGCDIQKEYYVGLVLDRATSRIVLMASEEGGTEIEEVAEKTPEKIVKVVIDPAIGLQGYQAREVAFKINIPTKLVGQAVKFMTSLYNAFIEKDCSIAEINPLVVTGDGKVMALDAKLNFDSNALYRQKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_SULNB (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sulfurovum sp. (strain NBC37-1) GN=sucC PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 4.271e-43
Identity = 94/236 (39.83%), Postives = 145/236 (61.44%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLA-PKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQ 730
            +N+HEYQ  ++ A+YG+  PKG+   SVD   +A +++       VVK+QI AGGRGLG       GGV + K  +EV +LA ++LG  LVT QTGP+GK+V K+Y+ +   + +E Y +++LDRK   P+I+  ++GG +IED+AE  P  I+ VP+D   G       ++  GL     A++ + I   +KLYKL+ + D  ++EINPL  T   + +A D K+ FD++A +RQ
Sbjct:    1 MNVHEYQAKQIFAEYGVPTPKGIMAESVDAAVEAAKEL--GGPIWVVKAQIHAGGRGLG-------GGVKLAKSLDEVRELADEILGMTLVTHQTGPEGKLVQKLYIEDGADIKDEFYLSVILDRKLEMPLIMASTEGGMNIEDVAENTPEKIITVPVDPTIGFQGFHGRELAFGLGITDKAEQKNIITFAQKLYKLYMDKDAEMIEINPLVRTGSGEFLALDGKMGFDNSALYRQ 227          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BRUSU (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella suis GN=sucC PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 7.285e-43
Identity = 102/237 (43.04%), Postives = 142/237 (59.92%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+  YG  +  G+AV SV++ ++  + +       VVKSQI AGGRG G FK   +  KGGV + K  EEV   A +MLG  LVTKQTG  GK V+++Y+ +   +  E+Y +I++DR    P  +  ++GG  IE +AE+ P  IV V ID   G+TDEDA K+ D L  +   R D ++    LYK F E D +LLEINPL   +  ++   DAK++FD+NA FR
Sbjct:    1 MNIHEYQAKRLLHTYGAPIANGVAVYSVEQAEEWAKTL--PGPLYVVKSQIHAGGRGKGKFKELPADAKGGVRLAKSVEEVVANAKEMLGNTLVTKQTGEAGKQVNRLYIEDGADIERELYLSILIDRSVGRPAFVVSTEGGMDIEAVAEETPEKIVTVAIDPAKGVTDEDANKLADALKLEGGAREDGLKLFPILYKAFTEKDMSLLEINPLIVMTNGRVRVLDAKVSFDNNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BRUSI (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=sucC PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 7.285e-43
Identity = 102/237 (43.04%), Postives = 142/237 (59.92%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+  YG  +  G+AV SV++ ++  + +       VVKSQI AGGRG G FK   +  KGGV + K  EEV   A +MLG  LVTKQTG  GK V+++Y+ +   +  E+Y +I++DR    P  +  ++GG  IE +AE+ P  IV V ID   G+TDEDA K+ D L  +   R D ++    LYK F E D +LLEINPL   +  ++   DAK++FD+NA FR
Sbjct:    1 MNIHEYQAKRLLHTYGAPIANGVAVYSVEQAEEWAKTL--PGPLYVVKSQIHAGGRGKGKFKELPADAKGGVRLAKSVEEVVANAKEMLGNTLVTKQTGEAGKQVNRLYIEDGADIERELYLSILIDRSVGRPAFVVSTEGGMDIEAVAEETPEKIVTVAIDPAKGVTDEDANKLADALKLEGGAREDGLKLFPILYKAFTEKDMSLLEINPLIVMTNGRVRVLDAKVSFDNNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BRUO2 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=sucC PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 7.285e-43
Identity = 102/237 (43.04%), Postives = 142/237 (59.92%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+  YG  +  G+AV SV++ ++  + +       VVKSQI AGGRG G FK   +  KGGV + K  EEV   A +MLG  LVTKQTG  GK V+++Y+ +   +  E+Y +I++DR    P  +  ++GG  IE +AE+ P  IV V ID   G+TDEDA K+ D L  +   R D ++    LYK F E D +LLEINPL   +  ++   DAK++FD+NA FR
Sbjct:    1 MNIHEYQAKRLLHTYGAPIANGVAVYSVEQAEEWAKTL--PGPLYVVKSQIHAGGRGKGKFKELPADAKGGVRLAKSVEEVVANAKEMLGNTLVTKQTGEAGKQVNRLYIEDGADIERELYLSILIDRSVGRPAFVVSTEGGMDIEAVAEETPEKIVTVAIDPAKGVTDEDANKLADALKLEGGAREDGLKLFPILYKAFTEKDMSLLEINPLIVMTNGRVRVLDAKVSFDNNALFR 235          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_DESAA1.734e-4443.28Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCB1_CAEEL6.589e-4443.75Probable succinyl-CoA ligase [ADP-forming] subunit... [more]
SUCB2_CAEEL8.605e-4439.84Probable succinyl-CoA ligase [GDP-forming] subunit... [more]
SUCC_CHLCH1.124e-4339.00Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_OCHA41.468e-4343.46Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACP23.270e-4341.42Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_SULNB4.271e-4339.83Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BRUSU7.285e-4343.04Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BRUSI7.285e-4343.04Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BRUO27.285e-4343.04Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top