FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BRUME (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella melitensis GN=sucC PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 7.285e-43
Identity = 102/237 (43.04%), Postives = 142/237 (59.92%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+  YG  +  G+AV SV++ ++  + +       VVKSQI AGGRG G FK   +  KGGV + K  EEV   A +MLG  LVTKQTG  GK V+++Y+ +   +  E+Y +I++DR    P  +  ++GG  IE +AE+ P  IV V ID   G+TDEDA K+ D L  +   R D ++    LYK F E D +LLEINPL   +  ++   DAK++FD+NA FR
Sbjct:    1 MNIHEYQAKRLLHTYGAPIANGVAVYSVEQAEEWAKTL--PGPLYVVKSQIHAGGRGKGKFKELPADAKGGVRLAKSVEEVVANAKEMLGNTLVTKQTGEAGKQVNRLYIEDGADIERELYLSILIDRSVGRPAFVVSTEGGMDIEAVAEETPEKIVTVAIDPAKGVTDEDANKLADALKLEGGAREDGLKLFPILYKAFTEKDMSLLEINPLIVMTNGRVRVLDAKVSFDNNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BRUMB (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=sucC PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 7.285e-43
Identity = 102/237 (43.04%), Postives = 142/237 (59.92%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+  YG  +  G+AV SV++ ++  + +       VVKSQI AGGRG G FK   +  KGGV + K  EEV   A +MLG  LVTKQTG  GK V+++Y+ +   +  E+Y +I++DR    P  +  ++GG  IE +AE+ P  IV V ID   G+TDEDA K+ D L  +   R D ++    LYK F E D +LLEINPL   +  ++   DAK++FD+NA FR
Sbjct:    1 MNIHEYQAKRLLHTYGAPIANGVAVYSVEQAEEWAKTL--PGPLYVVKSQIHAGGRGKGKFKELPADAKGGVRLAKSVEEVVANAKEMLGNTLVTKQTGEAGKQVNRLYIEDGADIERELYLSILIDRSVGRPAFVVSTEGGMDIEAVAEETPEKIVTVAIDPAKGVTDEDANKLADALKLEGGAREDGLKLFPILYKAFTEKDMSLLEINPLIVMTNGRVRVLDAKVSFDNNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BRUC2 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=sucC PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 7.285e-43
Identity = 102/237 (43.04%), Postives = 142/237 (59.92%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+  YG  +  G+AV SV++ ++  + +       VVKSQI AGGRG G FK   +  KGGV + K  EEV   A +MLG  LVTKQTG  GK V+++Y+ +   +  E+Y +I++DR    P  +  ++GG  IE +AE+ P  IV V ID   G+TDEDA K+ D L  +   R D ++    LYK F E D +LLEINPL   +  ++   DAK++FD+NA FR
Sbjct:    1 MNIHEYQAKRLLHTYGAPIANGVAVYSVEQAEEWAKTL--PGPLYVVKSQIHAGGRGKGKFKELPADAKGGVRLAKSVEEVVANAKEMLGNTLVTKQTGEAGKQVNRLYIEDGADIERELYLSILIDRSVGRPAFVVSTEGGMDIEAVAEETPEKIVTVAIDPAKGVTDEDANKLADALKLEGGAREDGLKLFPILYKAFTEKDMSLLEINPLIVMTNGRVRVLDAKVSFDNNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BRUAB (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella abortus GN=sucC PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 7.285e-43
Identity = 102/237 (43.04%), Postives = 142/237 (59.92%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+  YG  +  G+AV SV++ ++  + +       VVKSQI AGGRG G FK   +  KGGV + K  EEV   A +MLG  LVTKQTG  GK V+++Y+ +   +  E+Y +I++DR    P  +  ++GG  IE +AE+ P  IV V ID   G+TDEDA K+ D L  +   R D ++    LYK F E D +LLEINPL   +  ++   DAK++FD+NA FR
Sbjct:    1 MNIHEYQAKRLLHTYGAPIANGVAVYSVEQAEEWAKTL--PGPLYVVKSQIHAGGRGKGKFKELPADAKGGVRLAKSVEEVVANAKEMLGNTLVTKQTGEAGKQVNRLYIEDGADIERELYLSILIDRSVGRPAFVVSTEGGMDIEAVAEETPEKIVTVAIDPAKGVTDEDANKLADALKLEGGAREDGLKLFPILYKAFTEKDMSLLEINPLIVMTNGRVRVLDAKVSFDNNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BRUA1 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Brucella abortus (strain S19) GN=sucC PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 7.285e-43
Identity = 102/237 (43.04%), Postives = 142/237 (59.92%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+  YG  +  G+AV SV++ ++  + +       VVKSQI AGGRG G FK   +  KGGV + K  EEV   A +MLG  LVTKQTG  GK V+++Y+ +   +  E+Y +I++DR    P  +  ++GG  IE +AE+ P  IV V ID   G+TDEDA K+ D L  +   R D ++    LYK F E D +LLEINPL   +  ++   DAK++FD+NA FR
Sbjct:    1 MNIHEYQAKRLLHTYGAPIANGVAVYSVEQAEEWAKTL--PGPLYVVKSQIHAGGRGKGKFKELPADAKGGVRLAKSVEEVVANAKEMLGNTLVTKQTGEAGKQVNRLYIEDGADIERELYLSILIDRSVGRPAFVVSTEGGMDIEAVAEETPEKIVTVAIDPAKGVTDEDANKLADALKLEGGAREDGLKLFPILYKAFTEKDMSLLEINPLIVMTNGRVRVLDAKVSFDNNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_ACIBL (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidobacteria bacterium (strain Ellin345) GN=sucC PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 9.514e-43
Identity = 99/235 (42.13%), Postives = 140/235 (59.57%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDH-KELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + IHEYQG  ++ KYG+ VP+G  V + +E ++   D+  D  K +VVK+QI AGGRG G       GGV I K  +E   LAGK+LG  L+T QTGP+GK V ++ + E L +  E+Y +I+LDR    P+ +  + GG  IE++A K PN I+K  I+   G+    A K+   L  K      A++ ++ LYK + E+D +L+EINP   TS  +L A DAK NFDDN  FR
Sbjct:    1 MKIHEYQGKAILRKYGVAVPRGEMVTTREEAERVANDLMHDGAKGVVVKAQIHAGGRGKG-------GGVKIAKSVDEAGQLAGKILGMTLITHQTGPEGKKVQRLLIEETLPIERELYLSIVLDRSNGKPVFMASAAGGMEIEEVAAKDPNAIIKEWIEPGYGLGAFQARKIAFKLGLKPELIGQAVKFMQALYKTYDETDASLVEINPFITTSDNRLFALDAKFNFDDNGLFR 228          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACLD (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus licheniformis (strain DSM 13 / ATCC 14580) GN=sucC PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.615e-42
Identity = 100/239 (41.84%), Postives = 140/239 (58.58%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG E++ KYG+ VP+G    + DE  KA + +       VVK+QI AGGRG         GGV I K KEEV+  A ++LG+ LVT QTGP G+ + ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  IVK  ID   G+    A K+   +         A++ +  LYK F E DC++ EINPL  T   +++A DAKLNFD NA +RQK  L
Sbjct:    1 MNIHEYQGKEVLRKYGVAVPEGKVAFTADEAVKAAEAL--SSSVYVVKAQIHAGGRGKA-------GGVKIAKSKEEVKAYAEELLGKTLVTHQTGPDGQQIKRLLIEEGCDIKKEYYVGLVLDRATSRIVLMASEEGGTEIEEVAEKTPEKIVKEVIDPAVGLQSYQARKIAFAINIPKELVGQAVKFMMGLYKAFTEKDCSIAEINPLVVTGDGKVMALDAKLNFDSNALYRQKDIL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_EXIS2 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=sucC PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.722e-42
Identity = 96/234 (41.03%), Postives = 139/234 (59.40%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +N+HEYQ  EL+  YG+ VP G+A  +V+E   A + +    K  VVK+QI AGGRG         GGV + K +EEV++ A ++LG+ LVT QTGP+GK++ ++ + E  ++  E Y  I+LDR T   +I+G S+GG  IE++AE  P  I+K  +D   G+    A K+   +   V   N  +  V KLY  F + DC++ EINPL  T    ++A DAKLNFD NA +R
Sbjct:    1 MNVHEYQAKELLRSYGVPVPNGIAAFTVEEAVDAAEQLSGPIK--VVKAQIHAGGRGKA-------GGVKLAKSQEEVKEFATELLGKTLVTHQTGPEGKVIQRLLVEEGCAIDKEYYLGIVLDRVTGRVVIMGSSEGGMDIEEVAEATPEKIIKEVVDPAVGLQAFQARKLAFAMGVPVKLVNKFVGMVTKLYTFFVDKDCSIAEINPLVTTKDGDVLALDAKLNFDSNALYR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BART1 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=sucC PE=3 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 6.167e-42
Identity = 98/237 (41.35%), Postives = 140/237 (59.07%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+ +YG  +  G+AV S+++ +K  + +       VVKSQI AGGRG G FK      KGGV + +  EEV     +MLG+ LVTKQTGP+GK V+++Y+ +   +  E+Y ++++DR       +  ++GG  IE +AE+ P  I  +PIDV  G+T  D A++ D L    + R D  +    LYK FCE D +LLEINPL       L   DAK++FD+NA FR
Sbjct:    1 MNIHEYQAKRLLHEYGAPIANGVAVYSIEQAEKWAKKL--PGPLYVVKSQIHAGGRGKGQFKELGPDAKGGVRLAQSVEEVVANVQEMLGKTLVTKQTGPEGKQVNRLYIEDGADIERELYLSLLVDRSVGRIAFVVSTEGGMDIETVAEETPEKIFTLPIDVTEGVTSADCARLCDALELHDSAREDGEKLFPILYKAFCEKDMSLLEINPLIVMKDGHLRVLDAKVSFDNNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB_TRIVA (Succinyl-CoA ligase [GDP-forming] subunit beta, hydrogenosomal OS=Trichomonas vaginalis PE=1 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 6.167e-42
Identity = 94/240 (39.17%), Postives = 145/240 (60.42%), Query Frame = 2
Query:   23 RRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTF-KSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKR 736
            R  NI E+Q  E+ AKY +     L   S +E  +A + +  +    V+K+Q+  GGRG G + ++G K GVH VK  +E   +A +MLG  LVTKQTG  G +   V L + + +  E+YFAI+LDR+T  P++I  ++GG  IE++A  +P  I K  +D   GIT+E A  +   L       ++ + +++KL+KLF  SD T +E+NPLAET+  +++  D+K NFDD+A +RQK+
Sbjct:    8 RNFNILEWQSKEICAKYNVAAGINLVARSPEEAAEAFRKM--NLPAAVIKAQVYCGGRGKGHWLETGFKSGVHFVKSADEAAKIAKEMLGHHLVTKQTGKDGLLCQAVMLSDPVEVKRELYFAILLDRQTQSPVVIASTEGGVEIEEVAAHHPEKIHKFVLDGVEGITEEVAKNISTKLGLTGKAYDNGVVEMQKLWKLFVGSDATQVEVNPLAETTDGRIITVDSKFNFDDSAHYRQKQ 245          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_BRUME7.285e-4343.04Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BRUMB7.285e-4343.04Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BRUC27.285e-4343.04Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BRUAB7.285e-4343.04Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BRUA17.285e-4343.04Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_ACIBL9.514e-4342.13Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACLD3.615e-4241.84Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_EXIS24.722e-4241.03Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BART16.167e-4241.35Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCB_TRIVA6.167e-4239.17Succinyl-CoA ligase [GDP-forming] subunit beta, hy... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top