FC876179

Overview
NameFC876179
Unique NameFC876179
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10304 contig Ccv1_Contig10304:1..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SALPA (Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmonella paratyphi A GN=hemL PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.154e-50
Identity = 90/161 (55.90%), Postives = 119/161 (73.91%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            +  SE  ++ A+EL+PGGVNSPVRAF  VGG P+  +   G++++D+DG  YIDYVGSWGP ++GH    +  A+ E  ++G SFGAP  +E  +AE+V + VP+++MVR VNSGTEA M  +RLAR FTGR++I +FEGCYHGHAD  LVKAGSG  TLG
Sbjct:    1 MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVPTMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLG 161          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SALNS (Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmonella newport (strain SL254) GN=hemL PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.154e-50
Identity = 90/161 (55.90%), Postives = 119/161 (73.91%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            +  SE  ++ A+EL+PGGVNSPVRAF  VGG P+  +   G++++D+DG  YIDYVGSWGP ++GH    +  A+ E  ++G SFGAP  +E  +AE+V + VP+++MVR VNSGTEA M  +RLAR FTGR++I +FEGCYHGHAD  LVKAGSG  TLG
Sbjct:    1 MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVPTMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLG 161          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SALHS (Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmonella heidelberg (strain SL476) GN=hemL PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.154e-50
Identity = 90/161 (55.90%), Postives = 119/161 (73.91%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            +  SE  ++ A+EL+PGGVNSPVRAF  VGG P+  +   G++++D+DG  YIDYVGSWGP ++GH    +  A+ E  ++G SFGAP  +E  +AE+V + VP+++MVR VNSGTEA M  +RLAR FTGR++I +FEGCYHGHAD  LVKAGSG  TLG
Sbjct:    1 MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVPTMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLG 161          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SALG2 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=hemL PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.154e-50
Identity = 90/161 (55.90%), Postives = 119/161 (73.91%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            +  SE  ++ A+EL+PGGVNSPVRAF  VGG P+  +   G++++D+DG  YIDYVGSWGP ++GH    +  A+ E  ++G SFGAP  +E  +AE+V + VP+++MVR VNSGTEA M  +RLAR FTGR++I +FEGCYHGHAD  LVKAGSG  TLG
Sbjct:    1 MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVPTMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLG 161          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SALEP (Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmonella enteritidis PT4 (strain P125109) GN=hemL PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.154e-50
Identity = 90/161 (55.90%), Postives = 119/161 (73.91%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            +  SE  ++ A+EL+PGGVNSPVRAF  VGG P+  +   G++++D+DG  YIDYVGSWGP ++GH    +  A+ E  ++G SFGAP  +E  +AE+V + VP+++MVR VNSGTEA M  +RLAR FTGR++I +FEGCYHGHAD  LVKAGSG  TLG
Sbjct:    1 MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVPTMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLG 161          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SALDC (Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmonella dublin (strain CT_02021853) GN=hemL PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.154e-50
Identity = 90/161 (55.90%), Postives = 119/161 (73.91%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            +  SE  ++ A+EL+PGGVNSPVRAF  VGG P+  +   G++++D+DG  YIDYVGSWGP ++GH    +  A+ E  ++G SFGAP  +E  +AE+V + VP+++MVR VNSGTEA M  +RLAR FTGR++I +FEGCYHGHAD  LVKAGSG  TLG
Sbjct:    1 MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVPTMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLG 161          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SALCH (Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmonella choleraesuis GN=hemL PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.154e-50
Identity = 90/161 (55.90%), Postives = 119/161 (73.91%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            +  SE  ++ A+EL+PGGVNSPVRAF  VGG P+  +   G++++D+DG  YIDYVGSWGP ++GH    +  A+ E  ++G SFGAP  +E  +AE+V + VP+++MVR VNSGTEA M  +RLAR FTGR++I +FEGCYHGHAD  LVKAGSG  TLG
Sbjct:    1 MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVPTMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLG 161          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SALA4 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmonella agona (strain SL483) GN=hemL PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.154e-50
Identity = 90/161 (55.90%), Postives = 119/161 (73.91%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            +  SE  ++ A+EL+PGGVNSPVRAF  VGG P+  +   G++++D+DG  YIDYVGSWGP ++GH    +  A+ E  ++G SFGAP  +E  +AE+V + VP+++MVR VNSGTEA M  +RLAR FTGR++I +FEGCYHGHAD  LVKAGSG  TLG
Sbjct:    1 MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVPTMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLG 161          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_FRATN (Glutamate-1-semialdehyde 2,1-aminomutase OS=Francisella tularensis subsp. novicida (strain U112) GN=hemL PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.154e-50
Identity = 95/160 (59.38%), Postives = 120/160 (75.00%), Query Frame = 2
Query:  218 NSEEAFNVAKELMPGGVNSPVRAFKSVGGQ-PIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            NS+  F  A++ +PGGVNSPVRAFKSVG + P      KG++++D+D N+YIDY+GSWGP I+GH DD VL A+   +K G S+GAPC  E  LA+ +I  +P+IE VRFVNSGTEA M  +RLARA+TGR +I +FEGCYHGHAD FLV AGSG  +LG
Sbjct:    6 NSQILFAEAQQYIPGGVNSPVRAFKSVGQEFPRFIKFAKGAYLYDVDWNKYIDYIGSWGPMILGHCDDDVLEAIQCQVKNGLSYGAPCKQEVDLAKKIIELMPNIEQVRFVNSGTEATMSAIRLARAYTGRNKIIKFEGCYHGHADEFLVAAGSGALSLG 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_FLAPJ (Glutamate-1-semialdehyde 2,1-aminomutase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=hemL PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.154e-50
Identity = 90/160 (56.25%), Postives = 120/160 (75.00%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLG 694
            K S + F  A++++PGGVNSPVRAFKSVGG PI   S KG++++D DGN ++DY+ SWGP I+GHA + V+ A+ E  K GTSFG P  LE  +A++ +S V +I+ +RFVNSGTEACM  +RLAR FT R++I +F GCYHGH+D FL++AGSG  T G
Sbjct:    4 KRSSQLFLEAEKVIPGGVNSPVRAFKSVGGTPIFAKSAKGAYVYDEDGNRFVDYINSWGPMILGHAYEPVVTAVIEKAKSGTSFGMPTELETEIAKLAVSMVSNIDKIRFVNSGTEACMSAIRLARGFTKRDKIIKFAGCYHGHSDSFLIQAGSGAITFG 163          
The following BLAST results are available for this feature:
BLAST of FC876179 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GSA_SALPA9.154e-5055.90Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmon... [more]
GSA_SALNS9.154e-5055.90Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmon... [more]
GSA_SALHS9.154e-5055.90Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmon... [more]
GSA_SALG29.154e-5055.90Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmon... [more]
GSA_SALEP9.154e-5055.90Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmon... [more]
GSA_SALDC9.154e-5055.90Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmon... [more]
GSA_SALCH9.154e-5055.90Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmon... [more]
GSA_SALA49.154e-5055.90Glutamate-1-semialdehyde 2,1-aminomutase OS=Salmon... [more]
GSA_FRATN9.154e-5059.38Glutamate-1-semialdehyde 2,1-aminomutase OS=Franci... [more]
GSA_FLAPJ9.154e-5056.25Glutamate-1-semialdehyde 2,1-aminomutase OS=Flavob... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001C05EF DevOvary1 Citrus clementina cDNA clone C32001C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876179 ID=FC876179; Name=FC876179; organism=Citrus clementina; type=EST; length=698bp
GACAGTTTCTTATCTTGATTGACCGAGGAAAAGAGAAAGAGACATCAGAG
AGAGTGACACAAAAATGGCAGCTACAATTACAGGGGTAGGAGTTGGGTTA
GGGCTTTCATGTTCATCAAAGCTCACCAAGAGATTTTCTTCTTCTACTGG
ATCCTCTCGCTGTAGTGTTAAAATGTCGGTCTCTGTTGAGGAGCAGAAGA
AAAATTTCACTTTAAAAAACTCTGAAGAAGCTTTCAATGTCGCCAAGGAA
TTGATGCCTGGAGGTGTAAATTCACCTGTACGTGCCTTCAAATCTGTTGG
TGGTCAACCTATTGTGTTTGATTCCGTCAAGGGCTCACACATGTGGGATA
TCGATGGCAACGAGTACATTGACTATGTAGGTTCTTGGGGGCCGGCAATT
ATTGGTCACGCAGATGATCAGGTACTAGCAGCCTTGGGTGAAACAATGAA
GAAAGGAACCAGCTTTGGTGCTCCTTGTCTTCTAGAGAATGTTCTTGCAG
AAATGGTAATCTCAGCTGTTCCAAGCATAGAAATGGTTCGTTTTGTTAAC
TCAGGCACAGAAGCATGCATGGGTGTGCTTCGCCTTGCCCGTGCCTTCAC
TGGGAGAGAGAGGATCATNCAATTTGAGGGTTGTTATCATGGCCATGCTG
ATCCATTTCTTGTCAAGGCTGGTAGTGGAGTTGCCACCCTAGGGCTTC
back to top