FC876179

Overview
NameFC876179
Unique NameFC876179
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10304 contig Ccv1_Contig10304:1..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_POLNS (Glutamate-1-semialdehyde 2,1-aminomutase OS=Polynucleobacter necessarius (strain STIR1) GN=hemL PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.415e-42
Identity = 83/156 (53.21%), Postives = 108/156 (69.23%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVAT 688
            +E  F  A++ +PGGVNSPVRAF+ VGG P      KGS+ WD +   YID + SWGP I+GHA+ +V+AA+ +  +   S+GAP   E  LAE + + +PS+E VR V+SGTEA M  LRLAR +TGR+ I +FEGCYHGHAD  LVK GSG+ T
Sbjct:    7 NEALFERAQKTIPGGVNSPVRAFRQVGGIPRFVAKAKGSYFWDANDQRYIDLIMSWGPMIVGHANPEVVAAVQKAAETSFSYGAPTEGEIELAERICALMPSVEQVRMVSSGTEATMSALRLARGYTGRDLIIKFEGCYHGHADSLLVKVGSGLLT 162          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_MYCVP (Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=hemL PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.415e-42
Identity = 87/159 (54.72%), Postives = 103/159 (64.78%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            S + F  A  ++PGGVNSPVRAF SVGG P    S  G  + D DGN Y+D V SWGP I+GHA   V+ A+      G SFGAP   E  LA  +I  V  +E++R VNSGTEA M  +RLAR FTGR +I +F GCYHGH+D  L  AGSGVATLGL
Sbjct:    7 SAKLFADACSVIPGGVNSPVRAFSSVGGTPRFITSANGCWLTDADGNRYVDLVCSWGPMILGHAHPAVVEAVQRAAADGLSFGAPTPSEAELAREIIDRVAPVELIRLVNSGTEATMSAIRLARGFTGRAKIVKFSGCYHGHSDALLADAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_MYCTU (Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycobacterium tuberculosis GN=hemL PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.415e-42
Identity = 85/161 (52.80%), Postives = 103/161 (63.98%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            + S + F  A  ++PGGVNSPVRAF +VGG P       G  + D DGN Y+D V SWGP I+GHA   V+ A+ +   +G SFGAP   E  LA  +I  V  +E +R VNSGTEA M  +RLAR FTGR +I +F GCYHGH D  L  AGSGVATLGL
Sbjct:   16 RTSAQLFEAACSVIPGGVNSPVRAFTAVGGTPRFITEAHGCWLIDADGNRYVDLVCSWGPMILGHAHPAVVEAVAKAAARGLSFGAPTPAETQLAGEIIGRVAPVERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALLADAGSGVATLGL 176          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_MYCTA (Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=hemL PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.415e-42
Identity = 85/161 (52.80%), Postives = 103/161 (63.98%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            + S + F  A  ++PGGVNSPVRAF +VGG P       G  + D DGN Y+D V SWGP I+GHA   V+ A+ +   +G SFGAP   E  LA  +I  V  +E +R VNSGTEA M  +RLAR FTGR +I +F GCYHGH D  L  AGSGVATLGL
Sbjct:   16 RTSAQLFEAACSVIPGGVNSPVRAFTAVGGTPRFITEAHGCWLIDADGNRYVDLVCSWGPMILGHAHPAVVEAVAKAAARGLSFGAPTPAETQLAGEIIGRVAPVERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALLADAGSGVATLGL 176          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_MYCBT (Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=hemL PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.415e-42
Identity = 85/161 (52.80%), Postives = 103/161 (63.98%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            + S + F  A  ++PGGVNSPVRAF +VGG P       G  + D DGN Y+D V SWGP I+GHA   V+ A+ +   +G SFGAP   E  LA  +I  V  +E +R VNSGTEA M  +RLAR FTGR +I +F GCYHGH D  L  AGSGVATLGL
Sbjct:   16 RTSAQLFEAACSVIPGGVNSPVRAFTAVGGTPRFITEAHGCWLIDADGNRYVDLVCSWGPMILGHAHPAVVEAVAKAAARGLSFGAPTPAETQLAGEIIGRVAPVERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALLADAGSGVATLGL 176          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_MYCBP (Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=hemL PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.415e-42
Identity = 85/161 (52.80%), Postives = 103/161 (63.98%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            + S + F  A  ++PGGVNSPVRAF +VGG P       G  + D DGN Y+D V SWGP I+GHA   V+ A+ +   +G SFGAP   E  LA  +I  V  +E +R VNSGTEA M  +RLAR FTGR +I +F GCYHGH D  L  AGSGVATLGL
Sbjct:   16 RTSAQLFEAACSVIPGGVNSPVRAFTAVGGTPRFITEAHGCWLIDADGNRYVDLVCSWGPMILGHAHPAVVEAVAKAAARGLSFGAPTPAETQLAGEIIGRVAPVERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALLADAGSGVATLGL 176          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_MYCBO (Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycobacterium bovis GN=hemL PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.415e-42
Identity = 85/161 (52.80%), Postives = 103/161 (63.98%), Query Frame = 2
Query:  215 KNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            + S + F  A  ++PGGVNSPVRAF +VGG P       G  + D DGN Y+D V SWGP I+GHA   V+ A+ +   +G SFGAP   E  LA  +I  V  +E +R VNSGTEA M  +RLAR FTGR +I +F GCYHGH D  L  AGSGVATLGL
Sbjct:   16 RTSAQLFEAACSVIPGGVNSPVRAFTAVGGTPRFITEAHGCWLIDADGNRYVDLVCSWGPMILGHAHPAVVEAVAKAAARGLSFGAPTPAETQLAGEIIGRVAPVERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALLADAGSGVATLGL 176          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_THEFY (Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermobifida fusca (strain YX) GN=hemL PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.153e-42
Identity = 87/159 (54.72%), Postives = 107/159 (67.30%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            S E FN A+ ++PGGVNSPVRAFK+VGG P    S KG ++ D DGN Y+D + SWGP I+GHA   V+ AL +   +GTS+GAP   E  LAE ++S  P +E VR VNSGTEA M  +RLAR  TGR ++ +F G YHGH D  L  AGSGVAT  L
Sbjct:    7 SHELFNRARSVIPGGVNSPVRAFKAVGGTPPFMVSGKGPYLTDADGNTYVDLICSWGPLILGHAHPAVVEALAKAAAQGTSYGAPTEAEVELAEEIVSRTP-VEKVRLVNSGTEATMSAIRLARGATGRAKVVKFAGNYHGHVDALLAAAGSGVATFAL 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_MYCPA (Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycobacterium paratuberculosis GN=hemL PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.153e-42
Identity = 85/159 (53.46%), Postives = 105/159 (66.04%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            S   F+ A  ++PGGVNSPVRAF +VGG P    + +G  + D DGN Y+D V SWGP I+GHA   V+ A+ +    G SFGAP   E+ LA  +I+ V  +E +R VNSGTEA M  +RLAR FTGR +I +F GCYHGH D  L  AGSGVATLGL
Sbjct:   17 SARLFDDACAVIPGGVNSPVRAFTAVGGTPPFITAARGCRLTDADGNHYVDLVCSWGPMILGHAHPAVVEAVAKAAASGLSFGAPTPAESELAAEMIARVAPVERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALLADAGSGVATLGL 175          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_MYCA1 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycobacterium avium (strain 104) GN=hemL PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.153e-42
Identity = 85/159 (53.46%), Postives = 105/159 (66.04%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            S   F+ A  ++PGGVNSPVRAF +VGG P    + +G  + D DGN Y+D V SWGP I+GHA   V+ A+ +    G SFGAP   E+ LA  +I+ V  +E +R VNSGTEA M  +RLAR FTGR +I +F GCYHGH D  L  AGSGVATLGL
Sbjct:   17 SARLFDDACAVIPGGVNSPVRAFTAVGGTPPFITAARGCRLTDADGNHYVDLVCSWGPMILGHAHPAVVEAVAKAAASGLSFGAPTPAESELAAEMIARVAPVERIRLVNSGTEATMSAVRLARGFTGRAKIVKFSGCYHGHVDALLADAGSGVATLGL 175          
The following BLAST results are available for this feature:
BLAST of FC876179 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GSA_POLNS2.415e-4253.21Glutamate-1-semialdehyde 2,1-aminomutase OS=Polynu... [more]
GSA_MYCVP2.415e-4254.72Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycoba... [more]
GSA_MYCTU2.415e-4252.80Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycoba... [more]
GSA_MYCTA2.415e-4252.80Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycoba... [more]
GSA_MYCBT2.415e-4252.80Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycoba... [more]
GSA_MYCBP2.415e-4252.80Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycoba... [more]
GSA_MYCBO2.415e-4252.80Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycoba... [more]
GSA_THEFY3.153e-4254.72Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermo... [more]
GSA_MYCPA3.153e-4253.46Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycoba... [more]
GSA_MYCA13.153e-4253.46Glutamate-1-semialdehyde 2,1-aminomutase OS=Mycoba... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001C05EF DevOvary1 Citrus clementina cDNA clone C32001C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876179 ID=FC876179|Name=FC876179|organism=Citrus clementina|type=EST|length=698bp
GACAGTTTCTTATCTTGATTGACCGAGGAAAAGAGAAAGAGACATCAGAG
AGAGTGACACAAAAATGGCAGCTACAATTACAGGGGTAGGAGTTGGGTTA
GGGCTTTCATGTTCATCAAAGCTCACCAAGAGATTTTCTTCTTCTACTGG
ATCCTCTCGCTGTAGTGTTAAAATGTCGGTCTCTGTTGAGGAGCAGAAGA
AAAATTTCACTTTAAAAAACTCTGAAGAAGCTTTCAATGTCGCCAAGGAA
TTGATGCCTGGAGGTGTAAATTCACCTGTACGTGCCTTCAAATCTGTTGG
TGGTCAACCTATTGTGTTTGATTCCGTCAAGGGCTCACACATGTGGGATA
TCGATGGCAACGAGTACATTGACTATGTAGGTTCTTGGGGGCCGGCAATT
ATTGGTCACGCAGATGATCAGGTACTAGCAGCCTTGGGTGAAACAATGAA
GAAAGGAACCAGCTTTGGTGCTCCTTGTCTTCTAGAGAATGTTCTTGCAG
AAATGGTAATCTCAGCTGTTCCAAGCATAGAAATGGTTCGTTTTGTTAAC
TCAGGCACAGAAGCATGCATGGGTGTGCTTCGCCTTGCCCGTGCCTTCAC
TGGGAGAGAGAGGATCATNCAATTTGAGGGTTGTTATCATGGCCATGCTG
ATCCATTTCTTGTCAAGGCTGGTAGTGGAGTTGCCACCCTAGGGCTTC
back to top