FC876179

Overview
NameFC876179
Unique NameFC876179
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10304 contig Ccv1_Contig10304:1..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA1_STAA1 (Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hemL1 PE=3 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 2.487e-55
Identity = 108/159 (67.92%), Postives = 124/159 (77.99%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            SEEA  VA+ LMPGGVNSPVRAFKSV    I  D  KGS ++DIDGNEYIDYV SWGP I+GH D QV++ L E + KGTSFGA  LLEN LA++VI  VPSIE VR V+SGTEA +  LRLAR +TGR +I +FEGCYHGH+D  L+KAGSGVATLGL
Sbjct:    6 SEEAMKVAETLMPGGVNSPVRAFKSVDTPAIFMDHGKGSKIYDIDGNEYIDYVLSWGPLILGHRDPQVISHLHEAIDKGTSFGASTLLENKLAQLVIDRVPSIEKVRMVSSGTEATLDTLRLARGYTGRNKIVKFEGCYHGHSDSLLIKAGSGVATLGL 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_SOLUE (Glutamate-1-semialdehyde 2,1-aminomutase OS=Solibacter usitatus (strain Ellin6076) GN=hemL PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 3.248e-55
Identity = 103/163 (63.19%), Postives = 125/163 (76.69%), Query Frame = 2
Query:  209 TLKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            T   SEE F  A E +PGGVNSPVRAF+SVGGQP+     +GSH++D+DGNEYIDYVGSWGP I+GH   ++LAAL   ++ GTSFGAP   E  LA+ +I AVPS+EMVR VNSGTEA M  +R+AR FTGR+ + +FEGCYHGH D  LVKAGSG+ATLG+
Sbjct:    2 THTKSEELFRRAVEKIPGGVNSPVRAFRSVGGQPVFIARGQGSHLFDVDGNEYIDYVGSWGPLILGHRHPEILAALERALEIGTSFGAPTEQEIDLADAIIDAVPSVEMVRLVNSGTEATMSAIRVARGFTGRDLVVKFEGCYHGHVDSLLVKAGSGMATLGI 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_HERA2 (Glutamate-1-semialdehyde 2,1-aminomutase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=hemL PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 3.248e-55
Identity = 105/159 (66.04%), Postives = 128/159 (80.50%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            S  AF  A+ L+PGGVNSPVRAF+ VGG P   D   G++++DIDGN+YIDYV SWGP I+GHA   V+ A+    ++GTSFGAP  LE+ LAE+VI+AVPS+EMVRFV+SGTEA M  +RLARA+T RE+I +FEGCYHGHADPFLV+AGSGVATLGL
Sbjct:    6 SSAAFERAQALLPGGVNSPVRAFRGVGGVPRFIDHGAGAYLYDIDGNQYIDYVLSWGPLILGHAYPAVVEAICAQAQRGTSFGAPTELESELAELVIAAVPSVEMVRFVSSGTEAAMSAIRLARAYTQREKIIKFEGCYHGHADPFLVQAGSGVATLGL 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACCN (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus cereus subsp. cytotoxis (strain NVH 391-98) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.612e-54
Identity = 105/162 (64.81%), Postives = 126/162 (77.78%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            L  S +AF  A++LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+++V+ +L    +KGTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:    4 LDKSIKAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMEQGKGSKVYDIDGNEYIDYVLSWGPLIHGHANERVVESLKAVAEKGTSFGAPTEIENKLAQLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACWK (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 2.105e-54
Identity = 105/156 (67.31%), Postives = 122/156 (78.21%), Query Frame = 2
Query:  230 AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            AF  A+ LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+D+V+ AL    +KGTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:   10 AFEEAQNLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAEKGTSFGAPTEIENKLAQLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACCR (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.750e-54
Identity = 104/156 (66.67%), Postives = 123/156 (78.85%), Query Frame = 2
Query:  230 AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            AF  A++LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+D+V+ AL    ++GTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:   10 AFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKSVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACC4 (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus cereus (strain B4264) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.750e-54
Identity = 104/156 (66.67%), Postives = 123/156 (78.85%), Query Frame = 2
Query:  230 AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            AF  A++LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+D+V+ AL    ++GTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:   10 AFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKSVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA1_MACCJ (Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Macrococcus caseolyticus (strain JCSC5402) GN=hemL1 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.750e-54
Identity = 105/159 (66.04%), Postives = 123/159 (77.36%), Query Frame = 2
Query:  221 SEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            S++AF  A  LMPGGVNSPVRAFKSV   PI  +  KGS ++DIDGNEYIDYV SWGP I+GHA+D V  AL + +  GTSFGAP  LEN +AE+VI  VPSIEMVR V+SGTEA +  LRLAR FTG+ +I +F GCYHGH+D  L+KAGSGVATLGL
Sbjct:    6 SKQAFKEAVNLMPGGVNSPVRAFKSVDMDPIFMERGKGSKIYDIDGNEYIDYVLSWGPLILGHANDTVTGALNKAVLNGTSFGAPTELENKMAELVIERVPSIEMVRMVSSGTEATLAALRLARGFTGKNKILKFIGCYHGHSDSLLIKAGSGVATLGL 164          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA1_BACC2 (Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus cereus (strain G9842) GN=hemL1 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.750e-54
Identity = 104/156 (66.67%), Postives = 123/156 (78.85%), Query Frame = 2
Query:  230 AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            AF  A++LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+D+V+ AL    ++GTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:   10 AFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKSVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACHK (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus thuringiensis subsp. konkukian GN=hemL2 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.591e-54
Identity = 104/156 (66.67%), Postives = 123/156 (78.85%), Query Frame = 2
Query:  230 AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            AF  A++LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+D+V+ AL    ++GTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:   10 AFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
The following BLAST results are available for this feature:
BLAST of FC876179 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GSA1_STAA12.487e-5567.92Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Stap... [more]
GSA_SOLUE3.248e-5563.19Glutamate-1-semialdehyde 2,1-aminomutase OS=Soliba... [more]
GSA_HERA23.248e-5566.04Glutamate-1-semialdehyde 2,1-aminomutase OS=Herpet... [more]
GSA2_BACCN1.612e-5464.81Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA2_BACWK2.105e-5467.31Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA2_BACCR2.750e-5466.67Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA2_BACC42.750e-5466.67Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA1_MACCJ2.750e-5466.04Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Macr... [more]
GSA1_BACC22.750e-5466.67Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Baci... [more]
GSA2_BACHK3.591e-5466.67Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001C05EF DevOvary1 Citrus clementina cDNA clone C32001C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876179 ID=FC876179|Name=FC876179|organism=Citrus clementina|type=EST|length=698bp
GACAGTTTCTTATCTTGATTGACCGAGGAAAAGAGAAAGAGACATCAGAG
AGAGTGACACAAAAATGGCAGCTACAATTACAGGGGTAGGAGTTGGGTTA
GGGCTTTCATGTTCATCAAAGCTCACCAAGAGATTTTCTTCTTCTACTGG
ATCCTCTCGCTGTAGTGTTAAAATGTCGGTCTCTGTTGAGGAGCAGAAGA
AAAATTTCACTTTAAAAAACTCTGAAGAAGCTTTCAATGTCGCCAAGGAA
TTGATGCCTGGAGGTGTAAATTCACCTGTACGTGCCTTCAAATCTGTTGG
TGGTCAACCTATTGTGTTTGATTCCGTCAAGGGCTCACACATGTGGGATA
TCGATGGCAACGAGTACATTGACTATGTAGGTTCTTGGGGGCCGGCAATT
ATTGGTCACGCAGATGATCAGGTACTAGCAGCCTTGGGTGAAACAATGAA
GAAAGGAACCAGCTTTGGTGCTCCTTGTCTTCTAGAGAATGTTCTTGCAG
AAATGGTAATCTCAGCTGTTCCAAGCATAGAAATGGTTCGTTTTGTTAAC
TCAGGCACAGAAGCATGCATGGGTGTGCTTCGCCTTGCCCGTGCCTTCAC
TGGGAGAGAGAGGATCATNCAATTTGAGGGTTGTTATCATGGCCATGCTG
ATCCATTTCTTGTCAAGGCTGGTAGTGGAGTTGCCACCCTAGGGCTTC
back to top