FC876179

Overview
NameFC876179
Unique NameFC876179
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10304 contig Ccv1_Contig10304:1..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACCZ (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus cereus (strain ZK / E33L) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.591e-54
Identity = 104/156 (66.67%), Postives = 123/156 (78.85%), Query Frame = 2
Query:  230 AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            AF  A++LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+D+V+ AL    ++GTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:   10 AFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACCQ (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus cereus (strain Q1) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.591e-54
Identity = 104/156 (66.67%), Postives = 123/156 (78.85%), Query Frame = 2
Query:  230 AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            AF  A++LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+D+V+ AL    ++GTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:   10 AFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACC7 (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus cereus (strain AH187) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.591e-54
Identity = 104/156 (66.67%), Postives = 123/156 (78.85%), Query Frame = 2
Query:  230 AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            AF  A++LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+D+V+ AL    ++GTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:   10 AFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACC3 (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus cereus (strain 03BB102) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.591e-54
Identity = 104/156 (66.67%), Postives = 123/156 (78.85%), Query Frame = 2
Query:  230 AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            AF  A++LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+D+V+ AL    ++GTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:   10 AFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACC0 (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus cereus (strain AH820) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.591e-54
Identity = 104/156 (66.67%), Postives = 123/156 (78.85%), Query Frame = 2
Query:  230 AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            AF  A++LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+D+V+ AL    ++GTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:   10 AFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACAN (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus anthracis GN=hemL2 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.591e-54
Identity = 104/156 (66.67%), Postives = 123/156 (78.85%), Query Frame = 2
Query:  230 AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            AF  A++LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+D+V+ AL    ++GTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:   10 AFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACAH (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus thuringiensis (strain Al Hakam) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.591e-54
Identity = 104/156 (66.67%), Postives = 123/156 (78.85%), Query Frame = 2
Query:  230 AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            AF  A++LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+D+V+ AL    ++GTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:   10 AFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACAC (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.591e-54
Identity = 104/156 (66.67%), Postives = 123/156 (78.85%), Query Frame = 2
Query:  230 AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            AF  A++LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+D+V+ AL    ++GTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:   10 AFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA2_BACAA (Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus anthracis (strain A0248) GN=hemL2 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.591e-54
Identity = 104/156 (66.67%), Postives = 123/156 (78.85%), Query Frame = 2
Query:  230 AFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            AF  A++LMPGGVNSPVRAFKSVG  P+  +  KGS ++DIDGNEYIDYV SWGP I GHA+D+V+ AL    ++GTSFGAP  +EN LA++VI  VPSIE+VR VNSGTEA M  LRLAR +TGR +I +F GCYHGH D  L+KAGSGVATLGL
Sbjct:   10 AFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGL 165          
BLAST of FC876179 vs. ExPASy Swiss-Prot
Match: GSA_CARHZ (Glutamate-1-semialdehyde 2,1-aminomutase OS=Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008) GN=hemL PE=3 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 4.690e-54
Identity = 100/162 (61.73%), Postives = 126/162 (77.78%), Query Frame = 2
Query:  212 LKNSEEAFNVAKELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIXQFEGCYHGHADPFLVKAGSGVATLGL 697
            +  S EAF+ AK+++PGGVNSPVRAFKSVG  P+  +  +GS ++DIDGN YIDYVGSWGP I+GH   +V  AL   +KKGTSFGAP LLE  +AE++++A P+++MVR VNSGTEA M  +RLAR FTGR +I +FEGCYHGHAD  L+KAGSG  TLG+
Sbjct:    5 IDRSIEAFSEAKKVIPGGVNSPVRAFKSVGLNPVFIERGEGSKIYDIDGNCYIDYVGSWGPLILGHRHPKVEEALANCLKKGTSFGAPTLLETEMAEIIVNAFPAMDMVRMVNSGTEATMSAIRLARGFTGRNKIVKFEGCYHGHADSLLIKAGSGALTLGV 166          
The following BLAST results are available for this feature:
BLAST of FC876179 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
GSA2_BACCZ3.591e-5466.67Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA2_BACCQ3.591e-5466.67Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA2_BACC73.591e-5466.67Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA2_BACC33.591e-5466.67Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA2_BACC03.591e-5466.67Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA2_BACAN3.591e-5466.67Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA2_BACAH3.591e-5466.67Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA2_BACAC3.591e-5466.67Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA2_BACAA3.591e-5466.67Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Baci... [more]
GSA_CARHZ4.690e-5461.73Glutamate-1-semialdehyde 2,1-aminomutase OS=Carbox... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001C05EF DevOvary1 Citrus clementina cDNA clone C32001C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876179 ID=FC876179|Name=FC876179|organism=Citrus clementina|type=EST|length=698bp
GACAGTTTCTTATCTTGATTGACCGAGGAAAAGAGAAAGAGACATCAGAG
AGAGTGACACAAAAATGGCAGCTACAATTACAGGGGTAGGAGTTGGGTTA
GGGCTTTCATGTTCATCAAAGCTCACCAAGAGATTTTCTTCTTCTACTGG
ATCCTCTCGCTGTAGTGTTAAAATGTCGGTCTCTGTTGAGGAGCAGAAGA
AAAATTTCACTTTAAAAAACTCTGAAGAAGCTTTCAATGTCGCCAAGGAA
TTGATGCCTGGAGGTGTAAATTCACCTGTACGTGCCTTCAAATCTGTTGG
TGGTCAACCTATTGTGTTTGATTCCGTCAAGGGCTCACACATGTGGGATA
TCGATGGCAACGAGTACATTGACTATGTAGGTTCTTGGGGGCCGGCAATT
ATTGGTCACGCAGATGATCAGGTACTAGCAGCCTTGGGTGAAACAATGAA
GAAAGGAACCAGCTTTGGTGCTCCTTGTCTTCTAGAGAATGTTCTTGCAG
AAATGGTAATCTCAGCTGTTCCAAGCATAGAAATGGTTCGTTTTGTTAAC
TCAGGCACAGAAGCATGCATGGGTGTGCTTCGCCTTGCCCGTGCCTTCAC
TGGGAGAGAGAGGATCATNCAATTTGAGGGTTGTTATCATGGCCATGCTG
ATCCATTTCTTGTCAAGGCTGGTAGTGGAGTTGCCACCCTAGGGCTTC
back to top