FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ECO8A (60 kDa chaperonin OS=Escherichia coli O8 (strain IAI1) GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AM+KVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ECO81 (60 kDa chaperonin OS=Escherichia coli O81 (strain ED1a) GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AM+KVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ECO7I (60 kDa chaperonin OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AM+KVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ECO5E (60 kDa chaperonin OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AM+KVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ECO57 (60 kDa chaperonin OS=Escherichia coli O157:H7 GN=groL PE=3 SV=2)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AM+KVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ECO55 (60 kDa chaperonin OS=Escherichia coli (strain 55989 / EAEC) GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AM+KVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ECO45 (60 kDa chaperonin OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AM+KVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ECO27 (60 kDa chaperonin OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AM+KVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ECO24 (60 kDa chaperonin OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AM+KVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60C_DROME (60 kDa heat shock protein homolog 2, mitochondrial OS=Drosophila melanogaster GN=Hsp60C PE=2 SV=2)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 124/225 (55.11%), Postives = 168/225 (74.67%), Query Frame = 3
Query:   51 VLCNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            VL  RNY AKD+ FG   RA MLQGV  +A+AV VTMGPKGRNVIIE+S G+PK+TKDGVTVA SI  +DK +++GA LV+ VA  TN+ AGDGTT ATVL +AI  EG + ++ G + +++R G+ +AI+ V  +L+  ++ ++TPEEI QVATISANG++ +G L++ A++KVG++GVITV DG T+ +ELE + GMK  RGYISPYF+   K  K E ++ L
Sbjct:   20 VLWARNY-AKDVRFGPEVRAMMLQGVDVLADAVAVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIALKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISRGASPVEIRRGVMLAIETVKDNLRRLSRPVNTPEEICQVATISANGDKSVGNLISEAIKKVGRDGVITVKDGKTLCDELEVIEGMKFDRGYISPYFINTSKGAKVEFQDAL 243          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_ECO8A6.940e-6456.4860 kDa chaperonin OS=Escherichia coli O8 (strain I... [more]
CH60_ECO816.940e-6456.4860 kDa chaperonin OS=Escherichia coli O81 (strain ... [more]
CH60_ECO7I6.940e-6456.4860 kDa chaperonin OS=Escherichia coli O7:K1 (strai... [more]
CH60_ECO5E6.940e-6456.4860 kDa chaperonin OS=Escherichia coli O157:H7 (str... [more]
CH60_ECO576.940e-6456.4860 kDa chaperonin OS=Escherichia coli O157:H7 GN=g... [more]
CH60_ECO556.940e-6456.4860 kDa chaperonin OS=Escherichia coli (strain 5598... [more]
CH60_ECO456.940e-6456.4860 kDa chaperonin OS=Escherichia coli O45:K1 (stra... [more]
CH60_ECO276.940e-6456.4860 kDa chaperonin OS=Escherichia coli O127:H6 (str... [more]
CH60_ECO246.940e-6456.4860 kDa chaperonin OS=Escherichia coli O139:H28 (st... [more]
CH60C_DROME6.940e-6455.1160 kDa heat shock protein homolog 2, mitochondrial... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top