FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_NITHX (60 kDa chaperonin 2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=groL2 PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 121/215 (56.28%), Postives = 164/215 (76.28%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FGV AR  ML+GV  +A AVKVT+GPKGRNV++EKS G P++TKDGVTVA  IE  DK +++GA +V++VA  +  AAGDGTT ATVL QAI+ EG KSVAAG+N MDL+ GI +A++AV++DL   ++ +++ +EI QV TISANG+ EIG+ LA AM++VG EGVITV +  ++  EL+ V GM+  RGYISPYFVT+    + E+++
Sbjct:    3 AKDVKFGVDARDKMLRGVDILANAVKVTLGPKGRNVVLEKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKSADAAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLKRGIDLAVEAVVADLVRNSKKVTSNDEIAQVGTISANGDSEIGKFLANAMKRVGNEGVITVEEAKSLETELDVVEGMQFDRGYISPYFVTNADKMRVEMDD 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_ECOK1 (60 kDa chaperonin 1 OS=Escherichia coli O1:K1 / APEC GN=groL1 PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AM+KVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SHEWM (60 kDa chaperonin OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=groL PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 9.063e-64
Identity = 123/216 (56.94%), Postives = 160/216 (74.07%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  AR  ML GV+ +A AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A +++LK+ +Q  +    I QV TISAN +  IGE++A AMEKVGKEGVITV +G  + NEL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKEVLFGNDARVKMLAGVNVLANAVKVTLGPKGRNVVLDKSFGAPLITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVTEGLKAVAAGMNPMDLKRGIDKAVVAAVAELKNLSQECADTNAIAQVGTISANSDETIGEIIATAMEKVGKEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINKPETGSVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SHEDO (60 kDa chaperonin OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=groL PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 9.063e-64
Identity = 122/216 (56.48%), Postives = 160/216 (74.07%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  AR  ML GV+ +A AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+ EG K+VAAG+N MDL+ GI  A+ A +++LK  +Q  S  + I QV TISAN +  IGE++A AMEKVGKEGVITV +G  + NELE V GM+  RGY+SPYF+  P+T   EL++P
Sbjct:    3 AKEVKFGNDARVKMLAGVNILANAVKVTLGPKGRNVVLDKSFGSPVITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVVEGLKAVAAGMNPMDLKRGIDKAVIAAVAELKKLSQECSDTKAIAQVGTISANSDESIGEIIATAMEKVGKEGVITVEEGQALENELEVVEGMQFDRGYLSPYFINKPETGSIELDSP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SHEB8 (60 kDa chaperonin OS=Shewanella baltica (strain OS185) GN=groL PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 9.063e-64
Identity = 122/216 (56.48%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  AR  ML GV+ +A AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ A +++LK+ +Q  +  + I QVATISAN +  IGE++A AMEKVGKEGVITV +G  + NEL+ V GM+  RGY+SPYF+  P+T   EL++P
Sbjct:    3 AKEVVFGNDARVRMLAGVNILANAVKVTLGPKGRNVVLDKSFGSPLITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVVEGLKAVAAGMNPMDLKRGIDKAVIAAVAELKALSQPCADSKAIAQVATISANSDESIGEIIATAMEKVGKEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINKPETGSVELDHP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SHEB5 (60 kDa chaperonin OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=groL PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 9.063e-64
Identity = 122/216 (56.48%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  AR  ML GV+ +A AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ A +++LK+ +Q  +  + I QVATISAN +  IGE++A AMEKVGKEGVITV +G  + NEL+ V GM+  RGY+SPYF+  P+T   EL++P
Sbjct:    3 AKEVVFGNDARVRMLAGVNILANAVKVTLGPKGRNVVLDKSFGSPLITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVVEGLKAVAAGMNPMDLKRGIDKAVIAAVAELKALSQPCADSKAIAQVATISANSDESIGEIIATAMEKVGKEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINKPETGSVELDHP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_RHILW (60 kDa chaperonin OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=groL PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 9.063e-64
Identity = 123/215 (57.21%), Postives = 164/215 (76.28%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            +K+I FG  AR  ML+GV  +A+AVKVT+GPKGRNVII+KS G P++TKDGV+VA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A+  V+ DL+++A+ IST EE+ QV TISANG++++G  +A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 SKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGIDLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ECOL5 (60 kDa chaperonin OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=groL PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 9.063e-64
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AM+KVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVAAAVEELKTLSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ACTPL (60 kDa chaperonin OS=Actinobacillus pleuropneumoniae GN=groL PE=3 SV=3)

HSP 1 Score: 243.432 bits (620), Expect = 9.063e-64
Identity = 122/216 (56.48%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++K+ G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ AV+ +LK+ ++   T +EI QV TISAN +  +G+L+A+AMEKVGKEGVITV DG  + + L+ V GM+  RGY+SPYF+  P+    ELENP
Sbjct:    3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDKAYGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVVAVVEELKAISKPCETSKEIEQVGTISANSDETVGKLIAQAMEKVGKEGVITVEDGTGLDDALDVVEGMQFDRGYLSPYFINKPEAGTVELENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ACTPJ (60 kDa chaperonin OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=groL PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 9.063e-64
Identity = 122/216 (56.48%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++K+ G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ AV+ +LK+ ++   T +EI QV TISAN +  +G+L+A+AMEKVGKEGVITV DG  + + L+ V GM+  RGY+SPYF+  P+    ELENP
Sbjct:    3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDKAYGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVVAVVEELKAISKPCETSKEIEQVGTISANSDETVGKLIAQAMEKVGKEGVITVEDGTGLDDALDVVEGMQFDRGYLSPYFINKPEAGTVELENP 218          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH602_NITHX6.940e-6456.2860 kDa chaperonin 2 OS=Nitrobacter hamburgensis (s... [more]
CH601_ECOK16.940e-6456.4860 kDa chaperonin 1 OS=Escherichia coli O1:K1 / AP... [more]
CH60_SHEWM9.063e-6456.9460 kDa chaperonin OS=Shewanella woodyi (strain ATC... [more]
CH60_SHEDO9.063e-6456.4860 kDa chaperonin OS=Shewanella denitrificans (str... [more]
CH60_SHEB89.063e-6456.4860 kDa chaperonin OS=Shewanella baltica (strain OS... [more]
CH60_SHEB59.063e-6456.4860 kDa chaperonin OS=Shewanella baltica (strain OS... [more]
CH60_RHILW9.063e-6457.2160 kDa chaperonin OS=Rhizobium leguminosarum bv. t... [more]
CH60_ECOL59.063e-6456.4860 kDa chaperonin OS=Escherichia coli O6:K15:H31 (... [more]
CH60_ACTPL9.063e-6456.4860 kDa chaperonin OS=Actinobacillus pleuropneumoni... [more]
CH60_ACTPJ9.063e-6456.4860 kDa chaperonin OS=Actinobacillus pleuropneumoni... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top