FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_CAUCN (60 kDa chaperonin OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=groL PE=2 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.184e-63
Identity = 121/217 (55.76%), Postives = 161/217 (74.19%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            AKD+ F   AR  ML+GV+ +A AVKVT+GPKGRNV+IEKS G P+ TKDGV+VA  IE  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG KSVAAG+N MDL+ GI  A+   I D+K+ ++ ++T  EI QV TISANG++E+GE++A+AM+KVG EGVITV +  T   EL+ V GM+  RGY+SPYF+T+    + +LE PL
Sbjct:    3 AKDVYFSSDARDKMLRGVNILANAVKVTLGPKGRNVVIEKSFGAPRTTKDGVSVAKEIELADKFENLGAQMIREVASKTNDKAGDGTTTATVLAQAIVQEGLKSVAAGMNPMDLKRGIDKAVAIAIEDIKTSSKKVTTNAEIAQVGTISANGDKEVGEMIAKAMDKVGNEGVITVEEAKTAETELDVVEGMQFDRGYLSPYFITNADKMEVQLEEPL 219          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH607_BRAJA (60 kDa chaperonin 7 OS=Bradyrhizobium japonicum GN=groL7 PE=3 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.184e-63
Identity = 121/215 (56.28%), Postives = 162/215 (75.35%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ F   AR  ML+GV  +A AVKVT+GPKGRNV+IEKS G P++TKDGVTVA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A+ AVI D++ RA+ +++  E+ QV TISANG+  IG+++A+AM+KVG EGVITV +  ++  E++ V GMK  RGY+SPYFVT+ +    ELE+
Sbjct:    3 AKDVKFSGDARERMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDIAVAAVIKDIEKRAKPVASSSEVAQVGTISANGDAAIGKMIAQAMQKVGNEGVITVEENKSLDTEVDIVEGMKFDRGYLSPYFVTNAEKMTAELED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SHESR (60 kDa chaperonin OS=Shewanella sp. (strain MR-7) GN=groL PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.546e-63
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  AR  ML GV+ +A AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +Q  +  + I QV TISAN +  IGE++A AMEKVGKEGVITV +G  + NEL+ V GM+  RGY+SPYF+  P+T   EL++P
Sbjct:    3 AKEVVFGNDARVKMLAGVNILANAVKVTLGPKGRNVVLDKSFGSPLITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVTEGLKAVAAGMNPMDLKRGIDKAVAAAVIELKNLSQDCADSKAIAQVGTISANSDESIGEIIATAMEKVGKEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINKPETGSVELDHP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SHESM (60 kDa chaperonin OS=Shewanella sp. (strain MR-4) GN=groL PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.546e-63
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  AR  ML GV+ +A AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +Q  +  + I QV TISAN +  IGE++A AMEKVGKEGVITV +G  + NEL+ V GM+  RGY+SPYF+  P+T   EL++P
Sbjct:    3 AKEVVFGNDARVKMLAGVNILANAVKVTLGPKGRNVVLDKSFGSPLITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVTEGLKAVAAGMNPMDLKRGIDKAVAAAVIELKNLSQDCADSKAIAQVGTISANSDESIGEIIATAMEKVGKEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINKPETGSVELDHP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SALAR (60 kDa chaperonin OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=groL PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.546e-63
Identity = 121/216 (56.02%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AM+KVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPNITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVAAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_RALEH (60 kDa chaperonin OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=groL PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.546e-63
Identity = 121/216 (56.02%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  ARA M++GV+ +A AVKVT+GPKGRNV++E+S G P VTKDGV+VA  IE +DK +++GA +VK+VA  T+  AGDGTT ATVL Q+I+ EG K VAAG+N MDL+ GI  A+ A + +LK  ++  +T +EI QV  ISAN +  IGE +A AM+KVGKEGVITV DG ++ +ELE V GM+  RGY+SPYF+ +P+ Q  +L+NP
Sbjct:    3 AKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEIELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGIDKAVAAAVEELKKVSKPTTTSKEIAQVGAISANSDTSIGERIAEAMDKVGKEGVITVEDGKSLADELEVVEGMQFDRGYLSPYFINNPEKQVVQLDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_NITEC (60 kDa chaperonin OS=Nitrosomonas eutropha (strain C91) GN=groL PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.546e-63
Identity = 120/216 (55.56%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  AR+A++ GV+ +A+AVKVT+GPKGRNV++E+S G P +TKDGV+VA  IE +DK +++GA +VK+VA  T+  AGDGTT ATVL QAI+ EG + VAAG+N MDL+ GI+ A+ A + +LK  ++  ST +EI QV +ISAN + EIG ++A AM+KVGKEGVITV DG+ + NEL+ V GM+  RGY+SPYFV+  + Q   LENP
Sbjct:    3 AKEVRFGDAARSAVITGVNVLADAVKVTLGPKGRNVVLERSYGAPTITKDGVSVAKEIELKDKFENMGAQMVKEVASKTSDTAGDGTTTATVLAQAIVKEGMRYVAAGMNPMDLKRGIEKAVSAAVEELKKLSKPCSTSKEIAQVGSISANSDAEIGRIIAEAMDKVGKEGVITVEDGSGLENELDVVEGMQFDRGYLSPYFVSSAEKQIAALENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ENTS8 (60 kDa chaperonin OS=Enterobacter sakazakii (strain ATCC BAA-894) GN=groL PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.546e-63
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AMEKVGKEGVITV +G  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVVAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_RHORT (60 kDa chaperonin 2 OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=groL2 PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.546e-63
Identity = 120/216 (55.56%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ F   AR  +L+GV  +A AVKVT+GPKGRNV+++KS G P++TKDGV+VA  IE +DK +++GA +VK+VA  +   AGDGTT ATVL QAI+ EG KSVAAG+N MDL+ GI +A+ AV+ D+K R++ I T  E+ QV TISANG+ E+G+++A AMEKVG EGVITV +   +  EL+ V GM+  RGY+SPYFVT+ +    +LENP
Sbjct:    3 AKDVKFSTDARDRLLRGVDILANAVKVTLGPKGRNVVLDKSYGAPRITKDGVSVAKEIELKDKFENMGAQMVKEVASKSADVAGDGTTTATVLAQAIVREGVKSVAAGMNPMDLKRGIDLAVLAVVEDVKKRSKKIKTSAEVAQVGTISANGDEEVGKIIATAMEKVGNEGVITVEEAKGLDTELDVVEGMQFDRGYLSPYFVTNAEKMVADLENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_RHILO (60 kDa chaperonin 2 OS=Rhizobium loti GN=groL2 PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.546e-63
Identity = 120/216 (55.56%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ F   AR  ML+GV+ +A+AVKVT+GPKGRNV+I+KS G P++TKDGVTVA  IE  DK +++GA +V++VA  T+  AGDGTT ATVL QAI+ EG K+VA+G+N MDL+ GI  A++A++ +LK+ A+ ++  +EI QV TISANG+ EIG  LA AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYF+T+    + ELE P
Sbjct:    3 AKEVKFHSDAREKMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGIDKAVEAIVQELKTNARKVTRNDEIAQVGTISANGDAEIGRFLAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEEP 218          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_CAUCN1.184e-6355.7660 kDa chaperonin OS=Caulobacter crescentus (strai... [more]
CH607_BRAJA1.184e-6356.2860 kDa chaperonin 7 OS=Bradyrhizobium japonicum GN... [more]
CH60_SHESR1.546e-6356.4860 kDa chaperonin OS=Shewanella sp. (strain MR-7) ... [more]
CH60_SHESM1.546e-6356.4860 kDa chaperonin OS=Shewanella sp. (strain MR-4) ... [more]
CH60_SALAR1.546e-6356.0260 kDa chaperonin OS=Salmonella arizonae (strain A... [more]
CH60_RALEH1.546e-6356.0260 kDa chaperonin OS=Ralstonia eutropha (strain AT... [more]
CH60_NITEC1.546e-6355.5660 kDa chaperonin OS=Nitrosomonas eutropha (strain... [more]
CH60_ENTS81.546e-6356.4860 kDa chaperonin OS=Enterobacter sakazakii (strai... [more]
CH602_RHORT1.546e-6355.5660 kDa chaperonin 2 OS=Rhodospirillum rubrum (stra... [more]
CH602_RHILO1.546e-6355.5660 kDa chaperonin 2 OS=Rhizobium loti GN=groL2 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top