FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_DECAR (60 kDa chaperonin OS=Dechloromonas aromatica (strain RCB) GN=groL PE=3 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 2.019e-63
Identity = 120/216 (55.56%), Postives = 165/216 (76.39%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  ARA M++G++ +A+AVKVT+GPKGRNV++E+S G P VTKDGV+VA  IE +DK  ++GA +VK+VA  T+  AGDGTT ATVL Q+I+ EG K VAAG+N MDL+ GI  A+ A I++L++ ++  +T +EI QV +ISAN + +IGE++A AMEKVGKEGVITV DG ++ NEL+ V GM+  RGY+SPYF+ +   Q+  LENP
Sbjct:    3 AKEVKFGDSARARMVEGINILADAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEIELKDKFANMGAQMVKEVASKTSDIAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGIDKAVVATIAELQAFSKPCTTTKEIAQVGSISANSDSDIGEIIANAMEKVGKEGVITVEDGKSLANELDVVEGMQFDRGYLSPYFINNGDKQQALLENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_CITK8 (60 kDa chaperonin OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=groL PE=3 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 2.019e-63
Identity = 121/216 (56.02%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+L+A AM+KVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVAAAVEELKTLSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_RHILV (60 kDa chaperonin OS=Rhizobium leguminosarum bv. viciae GN=groL PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.637e-63
Identity = 122/215 (56.74%), Postives = 163/215 (75.81%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            +K+I FG   R  ML+GV  +A+AVKVT+GPKGRNVII+KS G P++TKDGV+VA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A+  V+ DL+++A+ IST EE+ QV TISANG++++G  +A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 SKEIKFGRTGREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGIDLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PSEPW (60 kDa chaperonin OS=Pseudomonas putida (strain W619) GN=groL PE=3 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.637e-63
Identity = 124/217 (57.14%), Postives = 159/217 (73.27%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            AKD+ FG  AR  ML GV+ +A+AVK T+GPKGRNV++ KS G P +TKDGV+VA  IE +D  +++GA LVK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A  AV+++LK+ ++  +  + I QV TISAN +  IGE++A AMEKVGKEGVITV +G+ + NEL  V GM+  RGY+SPYFV  P T   ELE+PL
Sbjct:    3 AKDVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEIELKDAFENMGAQLVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATAAVVAELKNLSKPCADSKAIAQVGTISANSDNSIGEIIAEAMEKVGKEGVITVEEGSGLENELSVVEGMQFDRGYLSPYFVNKPDTMVAELESPL 219          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PROMH (60 kDa chaperonin OS=Proteus mirabilis (strain HI4320) GN=groL PE=3 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.637e-63
Identity = 121/216 (56.02%), Postives = 159/216 (73.61%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG+ AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+   + +LK  +   S  + I QV TISAN +  +G L+A+AMEKVGKEGVITV +G  + +EL+ V GM+  RGY+SPYF+  P+T   ELENP
Sbjct:    3 AKDVKFGIDARNKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPVITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIIAEGLKAVAAGMNPMDLKRGIDKAVVGAVEELKKLSVPCSDTKAIAQVGTISANSDETVGTLIAQAMEKVGKEGVITVEEGTGLEDELDVVEGMQFDRGYLSPYFINKPETGTAELENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_CUPTR (60 kDa chaperonin OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=groL PE=3 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.637e-63
Identity = 121/216 (56.02%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  ARA M++GV+ +A AVKVT+GPKGRNV++E+S G P VTKDGV+VA  IE +DK +++GA +VK+VA  T+  AGDGTT ATVL Q+I+ EG K VAAG+N MDL+ GI  A+ A + +LK  ++  +T +EI QV  ISAN +  IGE +A AM+KVGKEGVITV DG ++ +ELE V GM+  RGY+SPYF+ +P+ Q   L+NP
Sbjct:    3 AKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEIELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGIDKAVGAAVEELKKISKPTTTSKEIAQVGAISANSDASIGERIAEAMDKVGKEGVITVEDGKSLADELEVVEGMQFDRGYLSPYFINNPEKQVVALDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH603_BURCM (60 kDa chaperonin 3 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=groL3 PE=3 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.637e-63
Identity = 122/217 (56.22%), Postives = 163/217 (75.12%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            AKD+ F   ARA +++GV+ +A+AVKVT+GPKGRNV+IE+S G P +TKDGV+VA  IE +D+ +++GA +VKQVA  T   AGDGTT ATVL QAI+ EG K VAAG+N MDL+ GI  A+ AV+ +L+  ++ IST  EI QV +ISAN +  IG+++A AMEKVGKEGVITV DG ++ NEL+ V GM+  RGY+SPYF+ DP+ Q   L++ L
Sbjct:    3 AKDVKFHDSARARIVKGVNVLADAVKVTLGPKGRNVVIERSFGAPTITKDGVSVAKEIELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGIDKAVAAVLDELRKLSKPISTNREIAQVGSISANADEAIGKIIADAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYVSPYFINDPEKQAAYLDDAL 219          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_PSYIN (60 kDa chaperonin 2 OS=Psychromonas ingrahamii (strain 37) GN=groL2 PE=3 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.637e-63
Identity = 120/217 (55.30%), Postives = 163/217 (75.12%), Query Frame = 3
Query:   72 VAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            ++K+I FG  +R+ ML GV+ +A+AVK+T+GPKGRNV+I+KS G P++TKDGVTVA  IE  DK +++GA +VK VA  TN AAGDGTT ATVL QAI+ +G K+VAAG+N MDL+ GI   + A +++LK  +   S  + ITQV TISAN + EIGE++ARAM+KVG +GVITV +G  +  EL+ V GM+  RGY+SPYF+T+ ++   ELENP
Sbjct:    1 MSKEIKFGNDSRSKMLNGVNILADAVKITLGPKGRNVVIDKSYGAPQITKDGVTVAKEIELEDKFENMGAQMVKDVASQTNDAAGDGTTTATVLAQAIIADGLKAVAAGMNPMDLKRGIDQTVKAAVAELKKLSTPCSDSKAITQVGTISANSDHEIGEIIARAMQKVGNQGVITVEEGQGLETELDVVEGMQFDRGYLSPYFMTNHESGTVELENP 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_VARPS (60 kDa chaperonin OS=Variovorax paradoxus (strain S110) GN=groL PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.444e-63
Identity = 122/216 (56.48%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  ARA M++GV+ +A AVKVT+GPKGRNV++E+S G P VTKDGV+VA  IE +DK +++GA LVK+VA  T+  AGDGTT ATVL QAI+ EG K VAAG+N MDL+ GI  A+ A++ +LK  ++  +T +EI QV +ISAN +  IG+L+A AM+KVGKEGVITV DG ++ +EL+ V GM+  RGY+SPYF+ +P+ Q   L+NP
Sbjct:    3 AKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKLQNMGAQLVKEVASKTSDNAGDGTTTATVLAQAIVREGFKYVAAGINPMDLKRGIDKAVTALVEELKKASKPTTTSKEIAQVGSISANSDETIGKLIADAMDKVGKEGVITVEDGKSLDSELDVVEGMQFDRGYLSPYFINNPEKQSALLDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SHESA (60 kDa chaperonin OS=Shewanella sp. (strain ANA-3) GN=groL PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.444e-63
Identity = 121/216 (56.02%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  AR  ML GV+ +A AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +Q  +  + I QV TISAN +  IG+++A AMEKVGKEGVITV +G  + NEL+ V GM+  RGY+SPYF+  P+T   EL++P
Sbjct:    3 AKEVVFGNDARVKMLAGVNILANAVKVTLGPKGRNVVLDKSFGSPLITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVTEGLKAVAAGMNPMDLKRGIDKAVAAAVIELKNLSQDCADSKAIAQVGTISANSDESIGQIIATAMEKVGKEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINKPETGSVELDHP 218          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_DECAR2.019e-6355.5660 kDa chaperonin OS=Dechloromonas aromatica (stra... [more]
CH60_CITK82.019e-6356.0260 kDa chaperonin OS=Citrobacter koseri (strain AT... [more]
CH60_RHILV2.637e-6356.7460 kDa chaperonin OS=Rhizobium leguminosarum bv. v... [more]
CH60_PSEPW2.637e-6357.1460 kDa chaperonin OS=Pseudomonas putida (strain W6... [more]
CH60_PROMH2.637e-6356.0260 kDa chaperonin OS=Proteus mirabilis (strain HI4... [more]
CH60_CUPTR2.637e-6356.0260 kDa chaperonin OS=Cupriavidus taiwanensis (stra... [more]
CH603_BURCM2.637e-6356.2260 kDa chaperonin 3 OS=Burkholderia ambifaria (str... [more]
CH602_PSYIN2.637e-6355.3060 kDa chaperonin 2 OS=Psychromonas ingrahamii (st... [more]
CH60_VARPS3.444e-6356.4860 kDa chaperonin OS=Variovorax paradoxus (strain ... [more]
CH60_SHESA3.444e-6356.0260 kDa chaperonin OS=Shewanella sp. (strain ANA-3)... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top