FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SHEAM (60 kDa chaperonin OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=groL PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.444e-63
Identity = 122/216 (56.48%), Postives = 159/216 (73.61%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  AR  ML GV+ +A AVKVT+GPKGRNV++EKS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ A + +LK+ +Q  +  + I QV TISAN +  IG+++A AMEKVGKEGVITV +G  + NEL+ V GM+  RGY+SPYF+  P+T   EL+NP
Sbjct:    3 AKEVVFGNDARVKMLAGVNILANAVKVTLGPKGRNVVLEKSFGAPLITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVAAAVVELKALSQECADSKAIAQVGTISANSDESIGDIIATAMEKVGKEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINKPETGAVELDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SERP5 (60 kDa chaperonin OS=Serratia proteamaculans (strain 568) GN=groL PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.444e-63
Identity = 121/216 (56.02%), Postives = 160/216 (74.07%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK  +   S  + I QV TISAN +  +G+L+A AMEKVGKEGVITV +G  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDETVGKLIAEAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SERMA (60 kDa chaperonin (Fragment) OS=Serratia marcescens GN=groL PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.444e-63
Identity = 121/216 (56.02%), Postives = 160/216 (74.07%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK  +   S  + I QV TISAN +  +G+L+A AMEKVGKEGVITV +G  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVVAAVEELKKLSVPCSDSKAIAQVGTISANSDETVGKLIAEAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGSVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SERFI (60 kDa chaperonin (Fragment) OS=Serratia ficaria GN=groL PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.444e-63
Identity = 121/216 (56.02%), Postives = 160/216 (74.07%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK  +   S  + I QV TISAN +  +G+L+A AMEKVGKEGVITV +G  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVVAAVEELKKLSVPCSDSKAIAQVGTISANSDETVGKLIAEAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGSVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_RALME (60 kDa chaperonin OS=Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) GN=groL PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.444e-63
Identity = 120/216 (55.56%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  ARA M++GV+ +A AVKVT+GPKGRNV++E+S G P VTKDGV+VA  IE +DK +++GA +VK+VA  T+  AGDGTT ATVL Q+I+ EG K VAAG+N MDL+ GI  A+ A + +LK  ++  +T +EI QV  ISAN +  IGE +A AM+KVGKEGVITV DG ++ +ELE V GM+  RGY+SPYF+ +P+ Q  +L++P
Sbjct:    3 AKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEIELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGIDKAVGAAVEELKKLSKPTTTSKEIAQVGAISANSDASIGERIAEAMDKVGKEGVITVEDGKSLADELEVVEGMQFDRGYLSPYFINNPEKQVVQLDSP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PSEPK (60 kDa chaperonin OS=Pseudomonas putida (strain KT2440) GN=groL PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.444e-63
Identity = 124/217 (57.14%), Postives = 158/217 (72.81%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            AKD+ FG  AR  ML GV+ +A+AVK T+GPKGRNV++ KS G P +TKDGV+VA  IE +D  +++GA LVK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A  AV+++LK+ ++  +  + I QV TISAN +  IGE++A AMEKVGKEGVITV +G+ + NEL  V GM+  RGY+SPYFV  P T   ELE PL
Sbjct:    3 AKDVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEIELKDAFENMGAQLVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATAAVVAELKNLSKPCADSKAIAQVGTISANSDNSIGEIIAEAMEKVGKEGVITVEEGSGLENELSVVEGMQFDRGYLSPYFVNKPDTMVAELEGPL 219          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PSEP1 (60 kDa chaperonin OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=groL PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.444e-63
Identity = 124/217 (57.14%), Postives = 158/217 (72.81%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            AKD+ FG  AR  ML GV+ +A+AVK T+GPKGRNV++ KS G P +TKDGV+VA  IE +D  +++GA LVK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A  AV+++LK+ ++  +  + I QV TISAN +  IGE++A AMEKVGKEGVITV +G+ + NEL  V GM+  RGY+SPYFV  P T   ELE PL
Sbjct:    3 AKDVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEIELKDAFENMGAQLVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATAAVVAELKNLSKPCADSKAIAQVGTISANSDNSIGEIIAEAMEKVGKEGVITVEEGSGLENELSVVEGMQFDRGYLSPYFVNKPDTMVAELEGPL 219          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_POLSJ (60 kDa chaperonin OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=groL PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.444e-63
Identity = 120/216 (55.56%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  ARA M++GV+ +A AVKVT+GPKGRNV++E+S G P VTKDGV+VA  IE +DK +++GA +VK+VA  T+  AGDGTT ATVL QAI+ EG K VAAG+N MDL+ GI  A+ A++ +LK  ++  +T +EI QV +ISAN +  IG+++A AM+KVGKEGVITV DG ++ +EL+ V GM+  RGY+SPYF+ +P+ Q   L+NP
Sbjct:    3 AKDVIFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKLQNMGAQMVKEVASKTSDIAGDGTTTATVLAQAIVREGMKYVAAGMNPMDLKRGIDKAVTALVEELKKASKATTTSKEIAQVGSISANSDEAIGKIIADAMDKVGKEGVITVEDGKSLESELDVVEGMQFDRGYLSPYFINNPEKQSAILDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ERWCT (60 kDa chaperonin OS=Erwinia carotovora subsp. atroseptica GN=groL PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.444e-63
Identity = 121/216 (56.02%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK ++   S  + I QV TISAN +  +G+L+A AMEKVGKEGVITV +G  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKKQSVPCSDFKAIAQVGTISANSDETVGKLIAEAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_VIBVY (60 kDa chaperonin 2 OS=Vibrio vulnificus (strain YJ016) GN=groL2 PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 3.444e-63
Identity = 120/216 (55.56%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ F   AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA +IE +DK +++GA +VKQVA   N  AGDGTT ATVL QA++ EG K+VAAG+N MDL+ GI  A+D+ +  L++ AQ  S  E ITQV +ISAN +R IG+++A AMEKVG+ GVITV +G  + NEL  V GM+  RGY+SPYF+T+  +   EL+NP
Sbjct:    3 AKDVLFANDARQKMLKGVNLLADAVKVTLGPKGRNVVLDKSYGAPSITKDGVSVAKAIELKDKFENMGAQMVKQVASKANDEAGDGTTTATVLAQALINEGLKAVAAGMNPMDLKRGIDKAVDSAVEKLRAMAQPCSDKESITQVGSISANSDRAIGDIIAEAMEKVGRNGVITVEEGQGLSNELSVVEGMQFDRGYLSPYFITNQDSGAVELDNP 218          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_SHEAM3.444e-6356.4860 kDa chaperonin OS=Shewanella amazonensis (strai... [more]
CH60_SERP53.444e-6356.0260 kDa chaperonin OS=Serratia proteamaculans (stra... [more]
CH60_SERMA3.444e-6356.0260 kDa chaperonin (Fragment) OS=Serratia marcescen... [more]
CH60_SERFI3.444e-6356.0260 kDa chaperonin (Fragment) OS=Serratia ficaria G... [more]
CH60_RALME3.444e-6355.5660 kDa chaperonin OS=Ralstonia metallidurans (stra... [more]
CH60_PSEPK3.444e-6357.1460 kDa chaperonin OS=Pseudomonas putida (strain KT... [more]
CH60_PSEP13.444e-6357.1460 kDa chaperonin OS=Pseudomonas putida (strain F1... [more]
CH60_POLSJ3.444e-6355.5660 kDa chaperonin OS=Polaromonas sp. (strain JS666... [more]
CH60_ERWCT3.444e-6356.0260 kDa chaperonin OS=Erwinia carotovora subsp. atr... [more]
CH602_VIBVY3.444e-6355.5660 kDa chaperonin 2 OS=Vibrio vulnificus (strain Y... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top