FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: HSP60_AJECA (Heat shock protein 60, mitochondrial OS=Ajellomyces capsulata GN=HSP60 PE=3 SV=2)

HSP 1 Score: 254.603 bits (649), Expect = 3.931e-67
Identity = 127/227 (55.95%), Postives = 170/227 (74.89%), Query Frame = 3
Query:   45 GRVLCNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            G  L  + +  K++ FGV  RAA+L+G+  +A+AV  T+GPKGRNV+IE S G+PK+TKDGVTVA ++  +DK +++GA L++ VA  TN+ AGDGTT ATVL +AI +E  K+VAAG N MDLR GI+ A++AV+  L++  + I+T EEI QVATISANG+  +G+L++ AMEKVGKEGVITV DG T+ +ELE   GM+  RGY+SPYF+TD K QK E E PL
Sbjct:   30 GLSLQQQRFAHKELKFGVEGRAALLKGIDTLAKAVCTTLGPKGRNVLIESSYGSPKITKDGVTVAKAVTLQDKFENLGARLLQDVASKTNEVAGDGTTTATVLARAIFSETVKNVAAGCNPMDLRRGIQAAVEAVVEYLQANKRDITTTEEIAQVATISANGDTHVGKLISNAMEKVGKEGVITVKDGKTIEDELEVTEGMRFDRGYVSPYFITDTKAQKVEFEKPL 256          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_ERYLH (60 kDa chaperonin 2 OS=Erythrobacter litoralis (strain HTCC2594) GN=groL2 PE=3 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 3.931e-67
Identity = 128/216 (59.26%), Postives = 165/216 (76.39%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  +L+GV  +A AVKVT+GPKGRNV+IEKS G P++TKDGVTVA  IE +DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG KSVAAG+N MDL+ GI +A+  V+ +LKSR++ ++  EEI QV  ISANG+RE+GE +A AMEKVGKEGVITV +   +  ELE+V GM+  RGY+SPYF+T+P     ELENP
Sbjct:    3 AKDVKFGRDAREGILKGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELKDKYENMGAQMLREVASKTNDLAGDGTTTATVLGQAIVREGMKSVAAGMNPMDLKRGIDIAVTKVVENLKSRSKDVAGSEEIAQVGIISANGDREVGEKIAEAMEKVGKEGVITVDESKGLEFELETVEGMQFDRGYLSPYFITNPDKMTVELENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH603_BRASB (60 kDa chaperonin 3 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=groL3 PE=3 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 6.706e-67
Identity = 127/216 (58.80%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ F   AR  ML+GV  +A AVKVT+GPKGRNV+IEKS G P++TKDGVTVA  IE  DK +++GA +V++VA  T   AGDGTT ATVL QAI+ EG KSVAAG+N MDL+ GI +A+DA+++DLK+ A+ I++ +EI QV TISANG+ EIG  LA AM+KVG EGVITV +  ++  ELE V GM+  RGY+SPYFVT+ +  + ELE+P
Sbjct:    3 AKDVKFSTDARDRMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTADLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGIDLAVDAIVADLKAHAKKITSNDEIAQVGTISANGDNEIGRFLAEAMQKVGNEGVITVEEAKSLDTELEVVEGMQFDRGYVSPYFVTNSEKMRVELEDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_GLUOX (60 kDa chaperonin OS=Gluconobacter oxydans GN=groL PE=3 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 2.548e-66
Identity = 125/216 (57.87%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV  +A AVKVT+GPKGRNV+++KS G P++TKDGV+VA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+  V+  LKS  + I++PEEI QV TISANGE EIGE++A AM+KVG EGVITV +   +  EL+ V GM+  RGYISPYFVT+P+    +L++P
Sbjct:    3 AKDVKFGADARERMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEIELADKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIIREGAKAVAAGMNPMDLKRGIDKAVGVVVDQLKSNTKKITSPEEIAQVGTISANGETEIGEMIASAMQKVGSEGVITVEEAKGLHTELDVVEGMQFDRGYISPYFVTNPEKMTADLDSP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_DROME (60 kDa heat shock protein, mitochondrial OS=Drosophila melanogaster GN=Hsp60 PE=1 SV=3)

HSP 1 Score: 251.521 bits (641), Expect = 3.328e-66
Identity = 128/226 (56.64%), Postives = 169/226 (74.78%), Query Frame = 3
Query:   48 RVLCNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            R L  R Y AKD+ FG   RA MLQGV  +A+AV VTMGPKGRNVIIE+S G+PK+TKDGVTVA SIE +DK +++GA LV+ VA  TN+ AGDGTT ATVL +AI  EG + ++ G N +++R G+ +A++ V  +LK+ ++ +STPEEI QVATISANG++ IG L++ AM+KVG++GVITV DG T+ +ELE + GMK  RGYISPYF+   K  K E ++ L
Sbjct:   15 RQLAMRGY-AKDVRFGPEVRAMMLQGVDVLADAVAVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPVEIRRGVMLAVETVKDNLKTMSRPVSTPEEIAQVATISANGDQAIGNLISEAMKKVGRDGVITVKDGKTLTDELEVIEGMKFDRGYISPYFINSSKGAKVEFQDAL 239          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_BRASO (60 kDa chaperonin 1 OS=Bradyrhizobium sp. (strain ORS278) GN=groL1 PE=3 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 3.328e-66
Identity = 126/216 (58.33%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ F   AR  ML+GV  +A AVKVT+GPKGRNV+IEKS G P++TKDGVTVA  IE  DK +++GA +V++VA  T   AGDGTT ATVL QAI+ EG KSVAAG+N MDL+ GI +A++A++ DLK+ A+ I++ +EI QV TISANG+ EIG  LA AM+KVG EGVITV +  ++  ELE V GM+  RGY+SPYFVT+ +  + ELE+P
Sbjct:    3 AKDVKFSTDARDRMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTADLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGIDLAVEAIVKDLKAHAKKITSNDEIAQVGTISANGDSEIGRFLAEAMQKVGNEGVITVEEAKSLDTELEVVEGMQFDRGYVSPYFVTNSEKMRVELEDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_TRYBB (Chaperonin HSP60, mitochondrial OS=Trypanosoma brucei brucei GN=HSP60 PE=2 SV=2)

HSP 1 Score: 251.136 bits (640), Expect = 4.347e-66
Identity = 123/221 (55.66%), Postives = 163/221 (73.76%), Query Frame = 3
Query:   57 CNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            C   + AKDI FG  AR +ML+GV    EAV  T+GPKGRNVIIE+S G PK+TKDGVTVA SIEF+D  +++GA LV+QV   TN  AGDGTT + VL  +I +EG KS+A G N +D++ G+  A++ ++ +++S+++ ++  E + QVATISANG+ E+G+L+  AMEKVGK+GVIT  DG T+  ELE V GM + RGYISPYFVTD KTQK ELE+
Sbjct:    4 CVVRFGAKDIRFGTEARQSMLKGVQRAVEAVATTLGPKGRNVIIEQSYGAPKITKDGVTVAKSIEFKDPFENMGAQLVRQVCNKTNDLAGDGTTTSAVLVASIFSEGIKSIATGTNPIDMKRGMDRAVEVILKNIESQSRTVTNTENVVQVATISANGDVELGKLIGEAMEKVGKDGVITTQDGKTLTTELEVVEGMSVDRGYISPYFVTDAKTQKAELED 224          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ACICJ (60 kDa chaperonin OS=Acidiphilium cryptum (strain JF-5) GN=groL PE=3 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 4.347e-66
Identity = 121/216 (56.02%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ F   AR  +++GV  +A AVKVT+GPKGRNV+IEKS G+P++TKDGVTVA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A++A++ +LK R + I+TP E  QV TISANGE EIG++++ AM+KVG EGVITV +   +  EL+ V GM+  RGY+SPYF+T+P+    +L+NP
Sbjct:    3 AKDVRFSADARERLIRGVDLLANAVKVTLGPKGRNVVIEKSFGSPRITKDGVTVAKEIELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDKAVNAIVDELKKRTKKITTPSETAQVGTISANGEAEIGKMISEAMQKVGNEGVITVEEAKGIQTELDVVEGMQFDRGYVSPYFITNPEKMVADLDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_MAGSA (60 kDa chaperonin OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=groL PE=3 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 5.677e-66
Identity = 125/216 (57.87%), Postives = 165/216 (76.39%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ F   AR  ML+GV  +A+AVKVT+GPKGRNV+IEKS G P++TKDGVTVA  IE  DK +++GA +V++VA  T   AGDGTT ATVL QAI+ EG K+VAAGLN MDL+ G+ +A+ AV++D+KSR++ ++T  EI QV TISANGE+EIG+++A+AMEKVG EGVITV +   +  EL+ V GM+  RGY SPYFVT+ +    EL+NP
Sbjct:    3 AKEVKFSTDARTRMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELADKFENMGAQMVREVASKTADLAGDGTTTATVLAQAIVREGVKAVAAGLNPMDLKRGVDLAVAAVVADVKSRSRKVATNAEIAQVGTISANGEKEIGDMIAKAMEKVGNEGVITVEEAKGLDTELDVVEGMQFDRGYTSPYFVTNAEKMTVELDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_GRABC (60 kDa chaperonin OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=groL PE=3 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 5.677e-66
Identity = 125/216 (57.87%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  IE  DK +++GA +V++VA  TN  AGDGTT ATVLTQAI+ EG K+VAAGLN MDL+ GI  A+  VI DLK+ ++ I+ P E  QV TISANGE EIG +++ AM+KVG EGVITV +   +  EL+ V GM+  RGY+SPYF+T+P+    EL+NP
Sbjct:    3 AKDVKFGGDARQRMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELADKFENMGAQMVREVASKTNDKAGDGTTTATVLTQAIVREGAKAVAAGLNPMDLKRGIDKAVAVVIEDLKANSRKITNPSETAQVGTISANGESEIGRMISEAMQKVGNEGVITVEEAKGIQTELDVVEGMQFDRGYVSPYFITNPEKMIAELDNP 218          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP60_AJECA3.931e-6755.95Heat shock protein 60, mitochondrial OS=Ajellomyce... [more]
CH602_ERYLH3.931e-6759.2660 kDa chaperonin 2 OS=Erythrobacter litoralis (st... [more]
CH603_BRASB6.706e-6758.8060 kDa chaperonin 3 OS=Bradyrhizobium sp. (strain ... [more]
CH60_GLUOX2.548e-6657.8760 kDa chaperonin OS=Gluconobacter oxydans GN=groL... [more]
CH60_DROME3.328e-6656.6460 kDa heat shock protein, mitochondrial OS=Drosop... [more]
CH601_BRASO3.328e-6658.3360 kDa chaperonin 1 OS=Bradyrhizobium sp. (strain ... [more]
CH60_TRYBB4.347e-6655.66Chaperonin HSP60, mitochondrial OS=Trypanosoma bru... [more]
CH60_ACICJ4.347e-6656.0260 kDa chaperonin OS=Acidiphilium cryptum (strain ... [more]
CH60_MAGSA5.677e-6657.8760 kDa chaperonin OS=Magnetospirillum magneticum (... [more]
CH60_GRABC5.677e-6657.8760 kDa chaperonin OS=Granulibacter bethesdensis (s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top