FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_POLNA (60 kDa chaperonin 2 OS=Polaromonas naphthalenivorans (strain CJ2) GN=groL2 PE=3 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 4.498e-63
Identity = 120/216 (55.56%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  ARA M++GV+ +A AVKVT+GPKGRNV++E+S G P VTKDGV+VA  IE +DK +++GA +VK+VA  T+  AGDGTT ATVL QAI+ EG K VAAG+N MDL+ GI  A+ A++ +LK  ++  +T +EI QV +ISAN +  IG+++A AM+KVGKEGVITV DG ++ +EL+ V GM+  RGY+SPYF+ +P+ Q   L+NP
Sbjct:    3 AKDVIFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKLQNMGAQMVKEVASKTSDIAGDGTTTATVLAQAIVHEGMKYVAAGMNPMDLKRGIDKAVHALVEELKKASKATTTSKEIAQVGSISANSDETIGKIIADAMDKVGKEGVITVEDGKSLESELDVVEGMQFDRGYLSPYFINNPEKQSALLDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_BURVG (60 kDa chaperonin 2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=groL2 PE=3 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 4.498e-63
Identity = 122/217 (56.22%), Postives = 164/217 (75.58%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            AKD+ F  GAR+ +++GV+ +A+AVKVT+GPKGRNV+IE+S G P +TKDGV+VA  IE +D+ +++GA +VKQVA  T   AGDGTT ATVL QAI+ EG K VAAG+N MDL+ GI  A+  V+ +L++ ++ IST +EI QV  ISAN +  IG+++A AMEKVGKEGVITV DG ++ NEL+ V GM+  RGYISPYF+ DP+ Q   L++ L
Sbjct:    3 AKDVKFRDGARSQIVKGVNVLADAVKVTLGPKGRNVVIERSFGAPVITKDGVSVAKEIELKDRFENMGAQIVKQVASKTADVAGDGTTTATVLAQAIVQEGMKHVAAGMNPMDLKRGIDKAVGVVLEELRTLSRPISTHKEIAQVGAISANADDAIGKIIADAMEKVGKEGVITVEDGKSLDNELDVVEGMQFDRGYISPYFINDPEKQAAYLDDAL 219          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_BRASO (60 kDa chaperonin 2 OS=Bradyrhizobium sp. (strain ORS278) GN=groL2 PE=3 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 4.498e-63
Identity = 120/215 (55.81%), Postives = 164/215 (76.28%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FGV AR  ML+GV  +A AVKVT+GPKGRNV+++KS G P++TKDGVTVA  IE  DK +++GA +V++VA  +  AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A++AV++DL   ++ +++ +EI QV TISANG+ EIG+ LA AM+KVG EGVITV +  ++  EL+ V GM+  RGYISPYFVT+    + E+++
Sbjct:    3 AKDVKFGVEARDRMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEIELDDKFENMGAQMVREVASKSADAAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDLAVEAVVADLVKNSKKVTSNDEIAQVGTISANGDSEIGKFLADAMKKVGNEGVITVEEAKSLETELDVVEGMQFDRGYISPYFVTNADKMRVEMDD 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_ROSDO (60 kDa chaperonin 1 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=groL1 PE=3 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 4.498e-63
Identity = 120/216 (55.56%), Postives = 158/216 (73.15%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ F   AR+ ML+GV+ +A+AVKVT+GPKGRNV+I+KS G P++TKDGVTVA  IE  DK +++GA +VK+VA  TN  AGDGTT +TVL QAI+ EG K+VAAG+N MDL+ GI +A   V+  +K+ A+ +   +E+ QV TISANGE EIG  +A AM+KVG +GVITV +   +  E E V GM+  RGY+SPYFVT+P     ELE+P
Sbjct:    3 AKDVKFDTAARSRMLRGVNTLADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVKEVASRTNDQAGDGTTTSTVLAQAIVNEGMKAVAAGMNPMDLKRGIDLATSKVVEAIKAAARDVKDSDEVAQVGTISANGEAEIGRQIADAMQKVGNDGVITVEENKGLETETEVVEGMQFDRGYLSPYFVTNPDKMTAELEDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SHEFN (60 kDa chaperonin OS=Shewanella frigidimarina (strain NCIMB 400) GN=groL PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 5.875e-63
Identity = 121/216 (56.02%), Postives = 160/216 (74.07%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  AR  ML GV+ +A AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ A +++LK  +Q  S  + I QV TISAN +  IG+++A AMEKVGKEGVITV +G  + NEL+ V GM+  RGY+SPYF+  P+T   EL++P
Sbjct:    3 AKEVLFGNDARVKMLAGVNILANAVKVTLGPKGRNVVLDKSFGSPMITKDGVSVAKEIELTDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVVEGLKAVAAGMNPMDLKRGIDKAVIAAVAELKLLSQECSDTKAIAQVGTISANSDESIGDIIATAMEKVGKEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINKPETGSIELDSP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_RALEJ (60 kDa chaperonin OS=Ralstonia eutropha (strain JMP134) GN=groL PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 5.875e-63
Identity = 120/216 (55.56%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  ARA M++GV+ +A AVKVT+GPKGRNV++E+S G P VTKDGV+VA  IE +DK +++GA +VK+VA  T+  AGDGTT ATVL Q+I+ EG K VAAG+N MDL+ GI  A+ A + +LK  ++  +T +EI QV  ISAN +  IGE +A AM+KVGKEGVITV DG ++ +ELE V GM+  RGY+SPYF+ +P+ Q  +L++P
Sbjct:    3 AKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEIELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKFVAAGMNPMDLKRGIDKAVAAAVEELKKVSKPTTTSKEIAQVGAISANSDTSIGERIAEAMDKVGKEGVITVEDGKSLADELEVVEGMQFDRGYLSPYFINNPEKQVVQLDSP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PECCP (60 kDa chaperonin OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=groL PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 5.875e-63
Identity = 120/216 (55.56%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+++A AM+KVGKEGVITV +G  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKMIAEAMDKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PECCC (60 kDa chaperonin (Fragment) OS=Pectobacterium carotovorum subsp. carotovorum GN=groL PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 5.875e-63
Identity = 120/216 (55.56%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   S  + I QV TISAN +  +G+++A AM+KVGKEGVITV +G  + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKMIAEAMDKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PANAN (60 kDa chaperonin (Fragment) OS=Pantoea ananas GN=groL PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 5.875e-63
Identity = 121/216 (56.02%), Postives = 159/216 (73.61%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK  +   S  + I QV TISAN +  +G L+A+AMEKVGKEGVITV +G  + +EL+ V GM+  RGY+SPYF+  P+T   ELE P
Sbjct:    3 AKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDQAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDETVGTLIAQAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELETP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_NOVAD (60 kDa chaperonin OS=Novosphingobium aromaticivorans (strain DSM 12444) GN=groL PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 5.875e-63
Identity = 119/216 (55.09%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  +L+GV  +A+AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  IE +DK +++GA ++++VA   N AAGDGTT ATVL QAI+ EG  +VAAG+N MDL+ GI +A+  V+ +LK+R+  ++   EI QV  ISANG+ E+G+ +A AMEKVGKEGVITV +   +  EL+ V GM+  RGY+SPYF+T+P+    ELENP
Sbjct:    3 AKDVKFGRDARERILRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELKDKFENMGAQMLREVASKANDAAGDGTTTATVLAQAIVREGMTAVAAGMNPMDLKRGIDIAVGKVVENLKARSTPVAGSSEIAQVGIISANGDTEVGQKIAEAMEKVGKEGVITVEEAKGLEFELDVVEGMQFDRGYLSPYFITNPEKMTVELENP 218          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH602_POLNA4.498e-6355.5660 kDa chaperonin 2 OS=Polaromonas naphthalenivora... [more]
CH602_BURVG4.498e-6356.2260 kDa chaperonin 2 OS=Burkholderia vietnamiensis ... [more]
CH602_BRASO4.498e-6355.8160 kDa chaperonin 2 OS=Bradyrhizobium sp. (strain ... [more]
CH601_ROSDO4.498e-6355.5660 kDa chaperonin 1 OS=Roseobacter denitrificans (... [more]
CH60_SHEFN5.875e-6356.0260 kDa chaperonin OS=Shewanella frigidimarina (str... [more]
CH60_RALEJ5.875e-6355.5660 kDa chaperonin OS=Ralstonia eutropha (strain JM... [more]
CH60_PECCP5.875e-6355.5660 kDa chaperonin OS=Pectobacterium carotovorum su... [more]
CH60_PECCC5.875e-6355.5660 kDa chaperonin (Fragment) OS=Pectobacterium car... [more]
CH60_PANAN5.875e-6356.0260 kDa chaperonin (Fragment) OS=Pantoea ananas GN=... [more]
CH60_NOVAD5.875e-6355.0960 kDa chaperonin OS=Novosphingobium aromaticivora... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top