FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_BRUME (60 kDa chaperonin OS=Brucella melitensis GN=groL PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.652e-65
Identity = 123/215 (57.21%), Postives = 165/215 (76.74%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+IEKS G P++TKDGV+VA  +E  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A++ V+++L  +A+ I+T EE+ QV TISANGE EIG+++A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEVELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGIDLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_BRUMB (60 kDa chaperonin OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=groL PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.652e-65
Identity = 123/215 (57.21%), Postives = 165/215 (76.74%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+IEKS G P++TKDGV+VA  +E  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A++ V+++L  +A+ I+T EE+ QV TISANGE EIG+++A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEVELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGIDLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_BRUAB (60 kDa chaperonin OS=Brucella abortus GN=groL PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.652e-65
Identity = 123/215 (57.21%), Postives = 165/215 (76.74%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+IEKS G P++TKDGV+VA  +E  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A++ V+++L  +A+ I+T EE+ QV TISANGE EIG+++A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEVELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGIDLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_BRUA2 (60 kDa chaperonin OS=Brucella abortus (strain 2308) GN=groL PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.652e-65
Identity = 123/215 (57.21%), Postives = 165/215 (76.74%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+IEKS G P++TKDGV+VA  +E  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A++ V+++L  +A+ I+T EE+ QV TISANGE EIG+++A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEVELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGIDLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_BRUA1 (60 kDa chaperonin OS=Brucella abortus (strain S19) GN=groL PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.652e-65
Identity = 123/215 (57.21%), Postives = 165/215 (76.74%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+IEKS G P++TKDGV+VA  +E  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A++ V+++L  +A+ I+T EE+ QV TISANGE EIG+++A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEVELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGIDLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ACTSZ (60 kDa chaperonin OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=groL PE=3 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 2.157e-65
Identity = 125/216 (57.87%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML GV+ +A+AVKVT+GPKGRNVI++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ AV+S+LK+ ++   T +EI QV TISAN +  +G+L+A+AMEKVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   E++NP
Sbjct:    3 AKDVKFGNDARVKMLAGVNVLADAVKVTLGPKGRNVILDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVAAVVSELKALSKPCETSKEIEQVGTISANSDSIVGQLIAQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVEMDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ACEP3 (60 kDa chaperonin OS=Acetobacter pasteurianus (strain NBRC 3283 / LMG 1513 / CCTM 1153) GN=groL PE=3 SV=2)

HSP 1 Score: 248.44 bits (633), Expect = 2.817e-65
Identity = 123/216 (56.94%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+++KS G P++TKDGV+VA  IE  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+  VI +LK  A+ ++TP E  QV TISANGE EIG++++ AM+KVG EGVITV +      EL+ V GM+  RGYISPYFVT+P+    +LENP
Sbjct:    3 AKDVKFGADARQRMLRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEIELADKFENMGAQMLREVASKTNDIAGDGTTTATVLAQAIVREGHKAVAAGMNPMDLKRGIDKAVAVVIEELKKNAKKVTTPAETAQVGTISANGESEIGQMISEAMQKVGSEGVITVEEAKHFQTELDVVEGMQFDRGYISPYFVTNPEKMTADLENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_BRAJA (60 kDa chaperonin 1 OS=Bradyrhizobium japonicum GN=groL1 PE=2 SV=3)

HSP 1 Score: 248.44 bits (633), Expect = 2.817e-65
Identity = 123/216 (56.94%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ F   AR  +L+GV  +A AVKVT+GPKGRNV+IEKS G P++TKDGVTVA  IE  DK +++GA +V++VA  T+  AGDGTT ATVL QAI+ EG KSVAAG+N MDL+ GI +A++A+++DLK+ A+ ++T EEI Q+ATISANG+ EIG  LA AM+KVG +GVITV +  ++  ELE V GM+  RGY SPYFVT+ +  + E E+P
Sbjct:    3 AKEVKFSTDARDRVLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTSDLAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGIDLAVEAIVNDLKAHAKKVTTNEEIAQIATISANGDIEIGRFLADAMQKVGNDGVITVEEAKSLDTELEVVEGMQFDRGYASPYFVTNAEKMRVEFEDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_HAEIN (60 kDa chaperonin OS=Haemophilus influenzae GN=groL PE=3 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 3.680e-65
Identity = 124/216 (57.41%), Postives = 165/216 (76.39%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGR+VI++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ AV+S+LK+ ++   T +EI QV TISAN +  +G+L+++AMEKVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   EL+NP
Sbjct:    3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRHVILDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLISQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_BRUSU (60 kDa chaperonin OS=Brucella suis GN=groL PE=3 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 3.680e-65
Identity = 122/215 (56.74%), Postives = 165/215 (76.74%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  +E  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A++ V+++L  +A+ I+T EE+ QV TISANGE EIG+++A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEVELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGIDLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLED 217          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_BRUME1.652e-6557.2160 kDa chaperonin OS=Brucella melitensis GN=groL P... [more]
CH60_BRUMB1.652e-6557.2160 kDa chaperonin OS=Brucella melitensis biotype 2... [more]
CH60_BRUAB1.652e-6557.2160 kDa chaperonin OS=Brucella abortus GN=groL PE=3... [more]
CH60_BRUA21.652e-6557.2160 kDa chaperonin OS=Brucella abortus (strain 2308... [more]
CH60_BRUA11.652e-6557.2160 kDa chaperonin OS=Brucella abortus (strain S19)... [more]
CH60_ACTSZ2.157e-6557.8760 kDa chaperonin OS=Actinobacillus succinogenes (... [more]
CH60_ACEP32.817e-6556.9460 kDa chaperonin OS=Acetobacter pasteurianus (str... [more]
CH601_BRAJA2.817e-6556.9460 kDa chaperonin 1 OS=Bradyrhizobium japonicum GN... [more]
CH60_HAEIN3.680e-6557.4160 kDa chaperonin OS=Haemophilus influenzae GN=gro... [more]
CH60_BRUSU3.680e-6556.7460 kDa chaperonin OS=Brucella suis GN=groL PE=3 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top