FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_VIBF1 (60 kDa chaperonin OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=groL PE=3 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 9.379e-61
Identity = 116/216 (53.70%), Postives = 159/216 (73.61%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   +  + I QV TISAN +  +G L+A AM+KVG++GVITV +G  + +EL+ V GM+  RGY+SPYFV + +    +LE+P
Sbjct:    3 AKDVKFGNDARIKMLEGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFQNMGAQMVKEVASQANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVVAAVEELKALSVPCADTKAIAQVGTISANSDSTVGNLIAEAMDKVGRDGVITVEEGQALQDELDVVEGMQFDRGYLSPYFVNNQEAGSVDLESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_RHOS1 (60 kDa chaperonin OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=groL PE=3 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 9.379e-61
Identity = 117/215 (54.42%), Postives = 156/215 (72.56%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ F   AR  ML+GV+ +A+AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  IE  DK +++GA +VK+VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A   V+  +K+ A+ ++   E+ QV TISANGE +IG  +A AM+KVG EGVITV +   +  E+E V GM+  RGY+SPYFVT+      EL++
Sbjct:    3 AKDVKFDTDARDRMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELSDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKEGLKAVAAGMNPMDLKRGIDLATSKVVEAIKAAARPVNDSHEVAQVGTISANGEAQIGRFIAEAMQKVGNEGVITVEENKGLETEVEVVEGMQFDRGYLSPYFVTNADKMTAELDD 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_RHOCA (60 kDa chaperonin OS=Rhodobacter capsulatus GN=groL PE=1 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 9.379e-61
Identity = 118/215 (54.88%), Postives = 156/215 (72.56%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AK++ F   AR  ML+GV+ +A+AVKVT+GPKGRNV+IEKS G P++TKDGV+VA  IE  DK +++GA +VK+VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A   V+  +K+ A+ +   +E+ QV TISANGE +IG  +A A +KVG EGVITV +   M  E+E V GM+  RGY+SPYFVT+P     +LE+
Sbjct:    3 AKEVKFSTDARDRMLKGVNILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEIELADKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVREGMKAVAAGMNPMDLKRGIDLATTTVVEAIKAAARPVKDSDEVAQVGTISANGEAQIGRFIADASQKVGNEGVITVEENKGMDTEVEVVEGMQFDRGYLSPYFVTNPDKMIADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_GEOUR (60 kDa chaperonin OS=Geobacter uraniireducens (strain Rf4) GN=groL PE=3 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 9.379e-61
Identity = 120/216 (55.56%), Postives = 158/216 (73.15%), Query Frame = 3
Query:   72 VAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            +AK I F    R A L+GV+ +A+AVKVT+GPKGRNV+IEKS G P +TKDGVTVA  IE  DK +++GA LVK+VA  T+  AGDGTT ATVL QAI  +G K VAAG N M+++ GI  A++ ++++LK+ ++ I   +EI QV TISAN ++ IG+++A AMEKVGKEGVITV +   M   LE+V GM+  RGY+SPYFVTDP+  +  LEN
Sbjct:    1 MAKIIKFDQEGRNAFLKGVNTLADAVKVTLGPKGRNVVIEKSFGAPLITKDGVTVAKEIELDDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGAKLVAAGHNPMEIKRGIDKAVETLVAELKNISKPIKDHKEIAQVGTISANNDKTIGDIIAEAMEKVGKEGVITVEEAKAMETTLETVEGMQFDRGYLSPYFVTDPERMEATLEN 216          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_GEOBB (60 kDa chaperonin OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=groL PE=3 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 9.379e-61
Identity = 118/215 (54.88%), Postives = 159/215 (73.95%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AK I F   AR  +L+GV+ +A+AVKVT+GPKGRNV+IEKS G P +TKDGVTVA  IE  DK +++GA LVK+VA  T+  AGDGTT ATVL QAI  +G K VAAG N M+++ G+  A++A++++LK+ ++ I   +EI QV TISAN ++ IG+++A AMEKVGKEGVITV +   M   LE+V GM+  RGY+SPYFVTDP+  +  ++N
Sbjct:    3 AKIIKFDQEARNCILKGVNTLADAVKVTLGPKGRNVVIEKSYGAPLITKDGVTVAKEIELEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGAKLVAAGHNPMEIKRGLDQAVEALVAELKNISKPIKDHKEIAQVGTISANNDKTIGDIIAEAMEKVGKEGVITVEEAKAMETTLETVEGMQFDRGYLSPYFVTDPERMEAAMDN 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_BUCTC (60 kDa chaperonin OS=Buchnera aphidicola subsp. Tetraneura caerulescens GN=groL PE=3 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 9.379e-61
Identity = 118/216 (54.63%), Postives = 156/216 (72.22%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N  AGDGTT AT+L QAI+ EG K+VAAG+N MDL+ GI  A+   +S+LK  +      + ITQV TISAN +  +G L++ AMEKVG +GVITV +G  + +ELE V GM+  RGY+SPYF+  P+T   ELENP
Sbjct:    3 AKDVKFGNEARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPSITKDGVSVAREIELEDKFENMGAQMVKEVASKANDVAGDGTTTATLLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVINAVSELKQLSVPCLDSKAITQVGTISANADETVGTLISEAMEKVGNDGVITVEEGTGLEDELEVVKGMQFDRGYLSPYFINKPETGIVELENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_TOLAT (60 kDa chaperonin OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=groL PE=3 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.225e-60
Identity = 116/216 (53.70%), Postives = 157/216 (72.69%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK+ +   +  + I QV TISAN +  +G+L+A AM+KVG++GVITV DG  + +EL  V GM+  RGY+SPYF+    T   EL++P
Sbjct:    3 AKDVKFGSDARIKMLEGVNVLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFQNMGAQMVKEVASQANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVLAAVEELKTLSVPCADTKAIAQVGTISANSDENVGKLIAEAMDKVGRDGVITVEDGQGLQDELAVVEGMQFDRGYLSPYFINKQDTASVELDDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_RICAH (60 kDa chaperonin OS=Rickettsia akari (strain Hartford) GN=groL PE=3 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.225e-60
Identity = 118/215 (54.88%), Postives = 158/215 (73.49%), Query Frame = 3
Query:   78 KDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            K I  G  AR  ML+G+  +A+AVKVT+GPKGRNV+IE+S G+PK+TKDGVTVA SIE +DK ++ GA L+K  A    + AGDGTT ATVL +A+  EG K VAAG N MDL+ G+ +A++AV+ ++K  ++ I++ EEI QV TIS+NG++EIGE +A+AME+VGKEGVITV +      ++E V GM   RGY+SPYFVT+ +    ELENP
Sbjct:    4 KLIKHGSKAREQMLEGIDVLADAVKVTLGPKGRNVLIEQSFGSPKITKDGVTVAKSIELKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGMDLAVNAVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEAKNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PSEPF (60 kDa chaperonin OS=Pseudomonas fluorescens (strain Pf0-1) GN=groL PE=3 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.225e-60
Identity = 121/217 (55.76%), Postives = 154/217 (70.97%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            AK++ FG  AR  ML GV+ +A+AVK T+GPKGRNVI+EKS G P +TKDGV+VA  IE  D+ +++GA LVK VA   N  AGDGTT ATVL Q+I+ EG K+VAAG+N MDL+ GI  A  AV+++LK  +   +  + I QV TISAN +  IG+++A AMEKVGKEGVITV +G+ + NEL  V GM+  RGY+SPYFV  P T   ELE  L
Sbjct:    3 AKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVILEKSFGAPTITKDGVSVAKEIELEDRFENMGAQLVKDVASRANDDAGDGTTTATVLAQSIVNEGLKAVAAGMNPMDLKRGIDKATIAVVAELKKLSAPCTDTKAIAQVGTISANSDNSIGDIIAEAMEKVGKEGVITVEEGSGLENELSVVEGMQFDRGYLSPYFVNKPDTMVAELEGAL 219          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PSEHT (60 kDa chaperonin OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=groL PE=3 SV=2)

HSP 1 Score: 233.032 bits (593), Expect = 1.225e-60
Identity = 118/217 (54.38%), Postives = 162/217 (74.65%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGK-EGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ F   ARA ML GV+ +A AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+ EG K+VAAG+N MDL+ GI  A+ A +++LK+ +   S  + I QV TISAN ++EIG+++A+AMEKVG+  GVITV +G ++ NEL+ V GM+  RGY+SPYF+  P+    EL+NP
Sbjct:    3 AKEVLFAGDARAKMLTGVNILANAVKVTLGPKGRNVVLDKSFGSPVITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVNEGLKAVAAGMNPMDLKRGIDKAVIAAVAELKALSVPCSDTKAIAQVGTISANSDKEIGDIIAQAMEKVGRNSGVITVEEGQSLENELDVVEGMQFDRGYLSPYFINSPEKGTVELDNP 219          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_VIBF19.379e-6153.7060 kDa chaperonin OS=Vibrio fischeri (strain ATCC ... [more]
CH60_RHOS19.379e-6154.4260 kDa chaperonin OS=Rhodobacter sphaeroides (stra... [more]
CH60_RHOCA9.379e-6154.8860 kDa chaperonin OS=Rhodobacter capsulatus GN=gro... [more]
CH60_GEOUR9.379e-6155.5660 kDa chaperonin OS=Geobacter uraniireducens (str... [more]
CH60_GEOBB9.379e-6154.8860 kDa chaperonin OS=Geobacter bemidjiensis (strai... [more]
CH60_BUCTC9.379e-6154.6360 kDa chaperonin OS=Buchnera aphidicola subsp. Te... [more]
CH60_TOLAT1.225e-6053.7060 kDa chaperonin OS=Tolumonas auensis (strain DSM... [more]
CH60_RICAH1.225e-6054.8860 kDa chaperonin OS=Rickettsia akari (strain Hart... [more]
CH60_PSEPF1.225e-6055.7660 kDa chaperonin OS=Pseudomonas fluorescens (stra... [more]
CH60_PSEHT1.225e-6054.3860 kDa chaperonin OS=Pseudoalteromonas haloplankti... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top