FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_ROSDO (60 kDa chaperonin 2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=groL2 PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.600e-60
Identity = 119/215 (55.35%), Postives = 156/215 (72.56%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ F   AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P++TKDGV+VA  IE  DK +++GA +VK+VA  TN  AGDGTT ATVL QAI+ EG KSVAAG+N MDL+ GI +A   V++ +K  A+ +S   E+ QV TISANGE EIG+ +A AM+KVG EGVITV +   +  E + V GM+  RGY+SPYFVT+      ELE+
Sbjct:    3 AKDVKFDTDARNRMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVKEGLKSVAAGMNPMDLKRGIDLATVKVVAAIKDAAREVSDSAEVAQVGTISANGEAEIGQQIADAMQKVGNEGVITVEENKGLETETDVVEGMQFDRGYLSPYFVTNADKMTTELED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_RHOSH (60 kDa chaperonin 1 OS=Rhodobacter sphaeroides GN=groL1 PE=1 SV=4)

HSP 1 Score: 232.646 bits (592), Expect = 1.600e-60
Identity = 117/215 (54.42%), Postives = 156/215 (72.56%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ F   AR  ML+GV+ +A+AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  IE  DK +++GA +VK+VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A   V+  +K+ A+ ++   E+ QV TISANGE +IG  +A AM+KVG EGVITV +   +  E+E V GM+  RGY+SPYFVT+      EL++
Sbjct:    3 AKDVKFDTDARDRMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELSDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKEGLKAVAAGMNPMDLKRGIDLATSKVVEAIKAAARPVNDSHEVAQVGTISANGEAQIGRFIADAMQKVGNEGVITVEENKGLETEVEVVEGMQFDRGYLSPYFVTNADKMTAELDD 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_RHOS4 (60 kDa chaperonin 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=groL1 PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.600e-60
Identity = 117/215 (54.42%), Postives = 156/215 (72.56%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ F   AR  ML+GV+ +A+AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  IE  DK +++GA +VK+VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A   V+  +K+ A+ ++   E+ QV TISANGE +IG  +A AM+KVG EGVITV +   +  E+E V GM+  RGY+SPYFVT+      EL++
Sbjct:    3 AKDVKFDTDARDRMLRGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELSDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIIKEGLKAVAAGMNPMDLKRGIDLATSKVVEAIKAAARPVNDSHEVAQVGTISANGEAQIGRFIADAMQKVGNEGVITVEENKGLETEVEVVEGMQFDRGYLSPYFVTNADKMTAELDD 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_RHILO (60 kDa chaperonin 1 OS=Rhizobium loti GN=groL1 PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.600e-60
Identity = 116/216 (53.70%), Postives = 156/216 (72.22%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK+I F   AR  ML+GV  +  AVKVT+GPKGRNVII+K+ G P++TKDGVTVA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL  +IL EG K VAAG+N MDL+ GI  A+ AV+ ++K++A+ + +  EI QV TI+ANG+  +G ++A+AM+KVG +GVITV +  T   EL+ V GM+  RGY+SPYFVT+    + ELE P
Sbjct:    3 AKEIKFATDARDRMLRGVEILTNAVKVTLGPKGRNVIIDKAYGAPRITKDGVTVAKEIELADKFENMGAQMVREVASKTNDLAGDGTTTATVLAASILREGAKLVAAGMNPMDLKRGIDQAVAAVVVEIKAKAKKVKSSAEIAQVGTIAANGDATVGAMIAKAMDKVGNDGVITVEEAKTAETELDVVEGMQFDRGYLSPYFVTNADKMRVELEEP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_RICPR (60 kDa chaperonin OS=Rickettsia prowazekii GN=groL PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.089e-60
Identity = 119/215 (55.35%), Postives = 157/215 (73.02%), Query Frame = 3
Query:   78 KDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            K I  G  AR  ML+G+  +A+AVKVT+GPKGRNV+IE+S G PK+TKDGVTVA SIE +DK K+ GA L+K  A    + AGDGTT ATVL +A+  EG K VAAG N MDL+ G+ +A++AV+ ++K  ++ I++ EEI QV TIS+NG++EIGE +A+AME+VGKEGVITV +      ++E V GM   RGY+SPYFVT+ +    ELENP
Sbjct:    4 KLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGAPKITKDGVTVAKSIELKDKIKNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGMDLAVNAVVEEIKRSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEAKNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PSEU2 (60 kDa chaperonin OS=Pseudomonas syringae pv. syringae (strain B728a) GN=groL PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.089e-60
Identity = 118/217 (54.38%), Postives = 156/217 (71.89%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            AK++ FG   R  ML GV+ +A+AVK T+GPKGRNVIIEKS G P +TKDGV+VA  IE +D+ +++GA LVK VA   N  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A  A++++LK  ++  +  + I QV TISAN +  IG+++A AMEKV K+GVITV +G+ + NEL  V GM+  RGY+SPYF+  P T   EL++PL
Sbjct:    3 AKEVKFGDSGRKKMLAGVNVLADAVKATLGPKGRNVIIEKSFGAPLITKDGVSVAKEIELKDRFENMGAQLVKDVASRANDDAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATIAIVAELKKLSKPCTDTKAIAQVGTISANSDHSIGDIIAEAMEKVTKDGVITVEEGSGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELDSPL 219          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PSESM (60 kDa chaperonin OS=Pseudomonas syringae pv. tomato GN=groL PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.089e-60
Identity = 118/217 (54.38%), Postives = 156/217 (71.89%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            AK++ FG   R  ML GV+ +A+AVK T+GPKGRNVIIEKS G P +TKDGV+VA  IE +D+ +++GA LVK VA   N  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A  A++++LK  ++  +  + I QV TISAN +  IG+++A AMEKV K+GVITV +G+ + NEL  V GM+  RGY+SPYF+  P T   EL++PL
Sbjct:    3 AKEVKFGDAGRKKMLAGVNVLADAVKATLGPKGRNVIIEKSFGAPLITKDGVSVAKEIELKDRFENMGAQLVKDVASRANDDAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATIAIVAELKKLSKPCTDTKAIAQVGTISANSDHSIGDIIAEAMEKVTKDGVITVEEGSGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELDSPL 219          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PSE14 (60 kDa chaperonin OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=groL PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.089e-60
Identity = 118/217 (54.38%), Postives = 156/217 (71.89%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            AK++ FG   R  ML GV+ +A+AVK T+GPKGRNVIIEKS G P +TKDGV+VA  IE +D+ +++GA LVK VA   N  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A  A++++LK  ++  +  + I QV TISAN +  IG+++A AMEKV K+GVITV +G+ + NEL  V GM+  RGY+SPYF+  P T   EL++PL
Sbjct:    3 AKEVKFGDSGRKKMLAGVNVLADAVKATLGPKGRNVIIEKSFGAPLITKDGVSVAKEIELKDRFENMGAQLVKDVASRANDDAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATIAIVAELKKLSKPCTDTKAIAQVGTISANSDHSIGDIIAEAMEKVTKDGVITVEEGSGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELDSPL 219          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ACIBY (60 kDa chaperonin OS=Acinetobacter baumannii (strain AYE) GN=groL PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.089e-60
Identity = 118/216 (54.63%), Postives = 157/216 (72.69%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR+ M+ GV+ +A+AVKVT+GPKGRNV+I++S G P +TKDGVTVA  I  +DK +++GA LV++V+  TN  AGDGTT ATVL QAIL EG KSV AG+N MDL+ GI +A+  V+ +++S A+     + I QV +ISAN +  +G+L+A+AMEKVGKEGVITV +G+   + L+ V GM+  RGYISPYF     T   ELENP
Sbjct:    3 AKDVKFGDSARSKMIAGVNVLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEISLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGIDIAVKTVVENIRSIAKPADDFKAIEQVGSISANSDTTVGKLIAQAMEKVGKEGVITVEEGSGFEDALDVVEGMQFDRGYISPYFANKQDTLTAELENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ACIBT (60 kDa chaperonin OS=Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755) GN=groL PE=3 SV=2)

HSP 1 Score: 232.261 bits (591), Expect = 2.089e-60
Identity = 118/216 (54.63%), Postives = 157/216 (72.69%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR+ M+ GV+ +A+AVKVT+GPKGRNV+I++S G P +TKDGVTVA  I  +DK +++GA LV++V+  TN  AGDGTT ATVL QAIL EG KSV AG+N MDL+ GI +A+  V+ +++S A+     + I QV +ISAN +  +G+L+A+AMEKVGKEGVITV +G+   + L+ V GM+  RGYISPYF     T   ELENP
Sbjct:    3 AKDVKFGDSARSKMIAGVNVLADAVKVTLGPKGRNVVIDRSFGAPHITKDGVTVAKEISLKDKFENMGAQLVREVSSKTNDIAGDGTTTATVLAQAILNEGIKSVTAGMNPMDLKRGIDIAVKTVVENIRSIAKPADDFKAIEQVGSISANSDTTVGKLIAQAMEKVGKEGVITVEEGSGFEDALDVVEGMQFDRGYISPYFANKQDTLTAELENP 218          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH602_ROSDO1.600e-6055.3560 kDa chaperonin 2 OS=Roseobacter denitrificans (... [more]
CH601_RHOSH1.600e-6054.4260 kDa chaperonin 1 OS=Rhodobacter sphaeroides GN=... [more]
CH601_RHOS41.600e-6054.4260 kDa chaperonin 1 OS=Rhodobacter sphaeroides (st... [more]
CH601_RHILO1.600e-6053.7060 kDa chaperonin 1 OS=Rhizobium loti GN=groL1 PE=... [more]
CH60_RICPR2.089e-6055.3560 kDa chaperonin OS=Rickettsia prowazekii GN=groL... [more]
CH60_PSEU22.089e-6054.3860 kDa chaperonin OS=Pseudomonas syringae pv. syri... [more]
CH60_PSESM2.089e-6054.3860 kDa chaperonin OS=Pseudomonas syringae pv. toma... [more]
CH60_PSE142.089e-6054.3860 kDa chaperonin OS=Pseudomonas syringae pv. phas... [more]
CH60_ACIBY2.089e-6054.6360 kDa chaperonin OS=Acinetobacter baumannii (stra... [more]
CH60_ACIBT2.089e-6054.6360 kDa chaperonin OS=Acinetobacter baumannii (stra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top