FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SACD2 (60 kDa chaperonin OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=groL PE=3 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 6.079e-60
Identity = 116/217 (53.46%), Postives = 157/217 (72.35%), Query Frame = 3
Query:   72 VAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            +AK + FG  AR  ML GV+ +A+AVK T+GPKGRNV+++KS G P VTKDGV+VA  IE  DK +++GA +VK+VA   +  AGDGTT ATVL QAI+ EG KSVAAG+N MDL+ GI  A++A ++ +KS AQ     + I QV TISAN +  +G+++A AM KVGKEGVITV +G+ + NEL+ V GM+  RGY+SPYF+ + ++   E+E P
Sbjct:    1 MAKIVKFGDEARQKMLAGVNVLADAVKTTLGPKGRNVVLDKSFGAPTVTKDGVSVAKEIELEDKFENMGAQMVKEVASKASDDAGDGTTTATVLAQAIVNEGLKSVAAGMNPMDLKRGIDKAVNAAVAHIKSIAQPCEDGKSIAQVGTISANSDSHVGDIIAEAMAKVGKEGVITVEEGSGLENELDVVEGMQFDRGYLSPYFINNQESMSVEIEQP 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_METCA (60 kDa chaperonin 2 OS=Methylococcus capsulatus GN=groL2 PE=3 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 6.079e-60
Identity = 117/216 (54.17%), Postives = 156/216 (72.22%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ F   AR  ML GV+ +A+AVK T+GPKGRNV++EKS G P VTKDGV+VA  IE +DK +++GA +VK+VA  T+  AGDGTT ATVL QAI+ EG KSVAAG N MD++ GI  A+  V+ +LK  ++  +  + I QV TISAN +  IG+++A+AM+ VGKEGVITV +G+ + NEL+ V GM+  RGY+SPYF+    T   ELENP
Sbjct:    3 AKEVRFSDDARHRMLAGVNILADAVKQTLGPKGRNVVLEKSFGAPVVTKDGVSVAKEIELKDKFENMGAQMVKEVASKTSDVAGDGTTTATVLAQAIVREGLKSVAAGANPMDIKRGIDQAVGVVVEELKKLSKPCTDSKAIAQVGTISANSDESIGQIIAQAMDTVGKEGVITVEEGSGLQNELDVVEGMQFDRGYLSPYFINKQDTMGVELENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_CHRVO (60 kDa chaperonin 1 OS=Chromobacterium violaceum GN=groL1 PE=3 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 6.079e-60
Identity = 115/217 (53.00%), Postives = 160/217 (73.73%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            AK++ F   AR  ++ GV+ +A+AVKVT+GPKGRNV++ +S G P +TKDGV+VA  IE +D  +++GA +VK+VA  T   AGDGTT ATVL QAI+ EG K VA+G+N MDL+ GI  A+ AVI +L++ ++ ++  +E  QVA +SAN +  IG+++A AM+KVGKEGVITV DG ++ NEL  V GM+  RGY+SPYF+TDP+ Q   LE+PL
Sbjct:    3 AKEVRFHDNARERIVNGVNVLADAVKVTLGPKGRNVLLARSFGAPHITKDGVSVAKEIELKDPFENMGAQMVKEVASKTADVAGDGTTTATVLAQAIVQEGMKYVASGMNPMDLKRGIDKAVHAVIKELQTLSKPVTNSKETAQVAALSANSDEAIGKIIADAMDKVGKEGVITVEDGKSLDNELAVVEGMQFDRGYLSPYFITDPEKQTAVLEDPL 219          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SILPO (60 kDa chaperonin OS=Silicibacter pomeroyi GN=groL PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 7.940e-60
Identity = 117/215 (54.42%), Postives = 155/215 (72.09%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ F   AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P++TKDGV+VA  IE  DK +++GA +VK+VA  TN  AGDGTT ATVL QAI+ EG KSVAAG+N MDL+ GI +A   V+  +K+ ++ ++   E+ QV TISANGE EIG  +A AM+KVG EGVITV +   +  E + V GM+  RGY+SPYFVT+      ELE+
Sbjct:    3 AKDVKFNTEARNKMLKGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVREGMKSVAAGMNPMDLKRGIDLATAKVVEAIKAASRPVNDSAEVAQVGTISANGESEIGRQIAEAMQKVGNEGVITVEENKGLETETDVVEGMQFDRGYLSPYFVTNADKMIAELED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_RICM5 (60 kDa chaperonin OS=Rickettsia massiliae (strain Mtu5) GN=groL PE=3 SV=2)

HSP 1 Score: 230.335 bits (586), Expect = 7.940e-60
Identity = 117/215 (54.42%), Postives = 157/215 (73.02%), Query Frame = 3
Query:   78 KDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            K I  G  AR  ML+G+  +A+AVKVT+GPKGRNV+IE+S G+PK+TKDGVTVA SI  +DK ++ GA L+K  A    + AGDGTT ATVL +A+  EG K VAAG N MDL+ G+ +A++AV+ ++K  ++ I++ EEI QV TIS+NG++EIGE +A+AME+VGKEGVITV +      ++E V GM   RGY+SPYFVT+ +    ELENP
Sbjct:    4 KLIKHGSKAREQMLEGIDILADAVKVTLGPKGRNVLIEQSFGSPKITKDGVTVAKSIALKDKIRNAGAQLLKSAATKAAEVAGDGTTTATVLARALAREGNKLVAAGYNPMDLKRGMDLAVNAVVEEIKKSSKKINSQEEIAQVGTISSNGDKEIGEKIAKAMEEVGKEGVITVEEAKNFSFDVEVVKGMMFDRGYLSPYFVTNSEKMVAELENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_FRATW (60 kDa chaperonin OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=groL PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 7.940e-60
Identity = 118/216 (54.63%), Postives = 155/216 (71.76%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK + F   ARA ML GV+ +A AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA  T   AGDGTT ATVL QA+LTEG K+VAAG+N MDL+ GI  A   ++ +LK+ ++  S P+ I QV TISAN +  +G+L+A AM KVGKEGVITV +G    +EL+ V GM+  RGY+SPYF T+ +    +LENP
Sbjct:    3 AKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGLKAVAAGMNPMDLKRGIDKATARLVEELKALSKPCSDPKSIEQVGTISANSDATVGKLIADAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_FRATN (60 kDa chaperonin OS=Francisella tularensis subsp. novicida (strain U112) GN=groL PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 7.940e-60
Identity = 118/216 (54.63%), Postives = 155/216 (71.76%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK + F   ARA ML GV+ +A AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA  T   AGDGTT ATVL QA+LTEG K+VAAG+N MDL+ GI  A   ++ +LK+ ++  S P+ I QV TISAN +  +G+L+A AM KVGKEGVITV +G    +EL+ V GM+  RGY+SPYF T+ +    +LENP
Sbjct:    3 AKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGLKAVAAGMNPMDLKRGIDKATAKLVEELKALSKPCSDPKSIEQVGTISANSDATVGKLIADAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_FRATM (60 kDa chaperonin OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=groL PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 7.940e-60
Identity = 118/216 (54.63%), Postives = 155/216 (71.76%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK + F   ARA ML GV+ +A AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA  T   AGDGTT ATVL QA+LTEG K+VAAG+N MDL+ GI  A   ++ +LK+ ++  S P+ I QV TISAN +  +G+L+A AM KVGKEGVITV +G    +EL+ V GM+  RGY+SPYF T+ +    +LENP
Sbjct:    3 AKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGLKAVAAGINPMDLKRGIDKATARLVEELKALSKPCSDPKSIEQVGTISANSDATVGKLIADAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_DESMR (60 kDa chaperonin OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=groL PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 7.940e-60
Identity = 118/217 (54.38%), Postives = 155/217 (71.43%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            AK+I F   AR  + +GV ++A AVKVT+GPKGRNV+IEKS G+P +TKDGVTVA  IE  DK +++GA +VK+VA  T+  AGDGTT AT+L QAI TEG K VAAG N M ++ GI  A+ +V+++L++ A+     +EI QV TISAN +  IG ++A AM KVGKEGVITV +   M   L+ V GM+  RGY+SPYF+TDP+   CEL+ PL
Sbjct:    3 AKEILFDSKAREKLKRGVDKLANAVKVTLGPKGRNVVIEKSFGSPIITKDGVTVAKEIELEDKFENMGAQMVKEVASKTSDIAGDGTTTATILAQAIFTEGVKLVAAGRNPMAIKRGIDKAVASVVAELETLAKPTRDQKEIAQVGTISANSDATIGNIIAEAMNKVGKEGVITVEEAKGMETTLDVVEGMQFDRGYLSPYFITDPERMVCELDEPL 219          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_CYTH3 (60 kDa chaperonin OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=groL PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 7.940e-60
Identity = 118/217 (54.38%), Postives = 157/217 (72.35%), Query Frame = 3
Query:   72 VAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            +AK I F   AR  + +GV  +A+AVKVT+GPKGRNVI++K  G+P +TKDGV+VA  IE +D  +++GA LVK+VA  T   AGDGTT ATVLTQAI   G K+VAAG N MDL+ GI  A+ A+I+DLK +++ IS   EI QVATISAN + EIG+++A AM+KVGK+GVITV +      E+++V GM+  RGY+SPYFVT+    + EL+ P
Sbjct:    1 MAKQILFDRDAREKLKKGVDALADAVKVTLGPKGRNVILDKKFGSPAITKDGVSVAKDIELKDAIENMGAQLVKEVASKTADQAGDGTTTATVLTQAIFNAGLKNVAAGANPMDLKRGIDKAVSAIIADLKVQSKKISNSNEIAQVATISANNDHEIGKMIAHAMDKVGKDGVITVEEAKGTETEVKTVEGMQFDRGYLSPYFVTNTDKMEVELDRP 217          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_SACD26.079e-6053.4660 kDa chaperonin OS=Saccharophagus degradans (str... [more]
CH602_METCA6.079e-6054.1760 kDa chaperonin 2 OS=Methylococcus capsulatus GN... [more]
CH601_CHRVO6.079e-6053.0060 kDa chaperonin 1 OS=Chromobacterium violaceum G... [more]
CH60_SILPO7.940e-6054.4260 kDa chaperonin OS=Silicibacter pomeroyi GN=groL... [more]
CH60_RICM57.940e-6054.4260 kDa chaperonin OS=Rickettsia massiliae (strain ... [more]
CH60_FRATW7.940e-6054.6360 kDa chaperonin OS=Francisella tularensis subsp.... [more]
CH60_FRATN7.940e-6054.6360 kDa chaperonin OS=Francisella tularensis subsp.... [more]
CH60_FRATM7.940e-6054.6360 kDa chaperonin OS=Francisella tularensis subsp.... [more]
CH60_DESMR7.940e-6054.3860 kDa chaperonin OS=Desulfovibrio magneticus (str... [more]
CH60_CYTH37.940e-6054.3860 kDa chaperonin OS=Cytophaga hutchinsonii (strai... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top