FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PSYCK (60 kDa chaperonin OS=Psychrobacter cryohalolentis (strain K5) GN=groL PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.310e-59
Identity = 119/221 (53.85%), Postives = 158/221 (71.49%), Query Frame = 3
Query:   72 VAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEE----ITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            +AKD+ FG+ AR  M+ GV+ +A AV+VT+GPKGRNV+I+KS G P +TKDGV+VA  IE  +K +++GA LV++VA  TN  AGDGTT ATVL Q+IL EG KSVAAG+N MDL+ GI  A+ A +  +     ++STP +    I QV +ISAN + +IGEL+A+AMEKVGK+GVITV +G++  + LE V GM+  RGYISPYF     +   E ENP
Sbjct:    1 MAKDVKFGIDARKQMMDGVNVLANAVRVTLGPKGRNVVIDKSFGAPTITKDGVSVAKEIELENKFENMGAQLVREVASRTNDVAGDGTTTATVLAQSILQEGMKSVAAGMNPMDLKRGIDKAVRAAVEQI----HLLSTPADDSKAIAQVGSISANSDTKIGELIAQAMEKVGKQGVITVEEGSSFEDTLEVVEGMQFDRGYISPYFANKQDSLTAEFENP 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PHOPR (60 kDa chaperonin OS=Photobacterium profundum GN=groL PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.310e-59
Identity = 114/216 (52.78%), Postives = 156/216 (72.22%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+ EG K+VAAG+N MDL+ GI  A+ A ++ LK  +      + I QV TISAN +  +G L+A AMEKVG++GVITV +G  + +EL+ V GM+  RGY+SPYF+ + +    +LE+P
Sbjct:    3 AKDVKFGNDARIKMLEGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFQNMGAQMVKEVASQANDAAGDGTTTATVLAQSIIAEGLKAVAAGMNPMDLKRGIDKAVIAAVAALKELSVPCEDTKAIAQVGTISANADATVGNLIAEAMEKVGRDGVITVEEGQALHDELDVVEGMQFDRGYLSPYFINNQEAGSIDLESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_FRATO (60 kDa chaperonin OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=groL PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.310e-59
Identity = 117/216 (54.17%), Postives = 154/216 (71.30%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK + F   ARA ML GV+ +A AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA  T   AGDGTT ATVL QA+LTEG K+V AG+N MDL+ GI  A   ++ +LK+ ++  S P+ I QV TISAN +  +G+L+A AM KVGKEGVITV +G    +EL+ V GM+  RGY+SPYF T+ +    +LENP
Sbjct:    3 AKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGLKAVTAGMNPMDLKRGIDKATARLVEELKALSKPCSDPKSIEQVGTISANSDATVGKLIADAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_FRATH (60 kDa chaperonin OS=Francisella tularensis subsp. holarctica (strain LVS) GN=groL PE=3 SV=2)

HSP 1 Score: 228.794 bits (582), Expect = 2.310e-59
Identity = 117/216 (54.17%), Postives = 154/216 (71.30%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK + F   ARA ML GV+ +A AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA  T   AGDGTT ATVL QA+LTEG K+V AG+N MDL+ GI  A   ++ +LK+ ++  S P+ I QV TISAN +  +G+L+A AM KVGKEGVITV +G    +EL+ V GM+  RGY+SPYF T+ +    +LENP
Sbjct:    3 AKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGLKAVTAGMNPMDLKRGIDKATARLVEELKALSKPCSDPKSIEQVGTISANSDATVGKLIADAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_FRATF (60 kDa chaperonin OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=groL PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.310e-59
Identity = 117/216 (54.17%), Postives = 154/216 (71.30%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK + F   ARA ML GV+ +A AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA  T   AGDGTT ATVL QA+LTEG K+V AG+N MDL+ GI  A   ++ +LK+ ++  S P+ I QV TISAN +  +G+L+A AM KVGKEGVITV +G    +EL+ V GM+  RGY+SPYF T+ +    +LENP
Sbjct:    3 AKQVLFSDEARAKMLDGVNTLANAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAKEIELEDKFENMGAQIVKEVASKTADVAGDGTTTATVLAQALLTEGLKAVTAGMNPMDLKRGIDKATARLVEELKALSKPCSDPKSIEQVGTISANSDATVGKLIADAMAKVGKEGVITVEEGKGFEDELDVVEGMQFDRGYLSPYFATNQENMTTDLENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_PARUW (60 kDa chaperonin 2 OS=Protochlamydia amoebophila (strain UWE25) GN=groL2 PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.310e-59
Identity = 114/215 (53.02%), Postives = 158/215 (73.49%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AK I F   AR  +L+GV  +A+AVKVT+GPKGRNV+I+KS G P +TKDGVTVA  IE  DK +++GA +VK+VA  T   AGDGTT ATVL +AI +EG ++VAAG N +DL+ G++ A+  ++ +LK R++ +    EI QVATISAN + EIGE++A+A+EKVG++G ITV +G     EL+ V GMK  RGY+S YF+T+ ++Q+C LE+
Sbjct:    3 AKIIKFKEDARQKILKGVRTLADAVKVTLGPKGRNVVIDKSYGTPHITKDGVTVAKEIELEDKFENMGAQMVKEVASKTADKAGDGTTTATVLAEAIYSEGLRNVAAGANPLDLKRGMEKAVKVIVQELKKRSKTVDDRNEIAQVATISANNDAEIGEMIAQAIEKVGRDGTITVEEGKGFETELDVVKGMKFDRGYLSAYFMTNSESQECILED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PSYA2 (60 kDa chaperonin OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=groL PE=3 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 3.017e-59
Identity = 119/221 (53.85%), Postives = 158/221 (71.49%), Query Frame = 3
Query:   72 VAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEE----ITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            +AKD+ FG+ AR  M+ GV+ +A AV+VT+GPKGRNV+I+KS G P +TKDGV+VA  IE  +K +++GA LV++VA  TN  AGDGTT ATVL Q+IL EG KSVAAG+N MDL+ GI  A+ A +  +     ++STP +    I QV +ISAN + +IGEL+A+AMEKVGK+GVITV +G++  + LE V GM+  RGYISPYF     +   E ENP
Sbjct:    1 MAKDVKFGIDARKQMMDGVNILANAVRVTLGPKGRNVVIDKSFGAPTITKDGVSVAKEIELENKFENMGAQLVREVASRTNDVAGDGTTTATVLAQSILQEGMKSVAAGMNPMDLKRGIDKAVRAAVEQI----HLLSTPADDSKAIAQVGSISANSDTKIGELIAQAMEKVGKQGVITVEEGSSFEDTLEVVEGMQFDRGYISPYFANKQDSLTAEFENP 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PARDP (60 kDa chaperonin OS=Paracoccus denitrificans (strain Pd 1222) GN=groL1 PE=3 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 3.017e-59
Identity = 117/215 (54.42%), Postives = 156/215 (72.56%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AK++ F   AR  ML+GV+ +A+AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A   V+  +KS A+ ++   E+ QV TISANGE  IG+ +A AM++VG EGVITV +   M  E+E V GM+  RGY+SPYFVT+      ELE+
Sbjct:    3 AKEVKFNSDARDRMLKGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELSDKFENMGAQMVREVASRTNDEAGDGTTTATVLAQAIVREGLKAVAAGMNPMDLKRGIDVATAKVVEAIKSAARPVNDSSEVAQVGTISANGESFIGQQIAEAMQRVGNEGVITVEENKGMETEVEVVEGMQFDRGYLSPYFVTNADKMIAELED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PARDE (60 kDa chaperonin OS=Paracoccus denitrificans GN=groL PE=1 SV=2)

HSP 1 Score: 228.409 bits (581), Expect = 3.017e-59
Identity = 117/215 (54.42%), Postives = 156/215 (72.56%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AK++ F   AR  ML+GV+ +A+AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A   V+  +KS A+ ++   E+ QV TISANGE  IG+ +A AM++VG EGVITV +   M  E+E V GM+  RGY+SPYFVT+      ELE+
Sbjct:    3 AKEVKFNSDARDRMLKGVNILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELSDKFENMGAQMVREVASRTNDEAGDGTTTATVLAQAIVREGLKAVAAGMNPMDLKRGIDVATAKVVEAIKSAARPVNDSSEVAQVGTISANGESFIGQQIAEAMQRVGNEGVITVEENKGMETEVEVVEGMQFDRGYLSPYFVTNADKMIAELED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH63_HELVI (63 kDa chaperonin, mitochondrial OS=Heliothis virescens PE=1 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 3.941e-59
Identity = 113/219 (51.60%), Postives = 157/219 (71.69%), Query Frame = 3
Query:   69 YVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            + AK++ FG   R+ MLQGV  +A+A  VTMGPKG NVI+ K++G PK+TKDGVTVA  I+ +DK +++GA LV+ VA  TN+ AGDGTT ATVL + I  EG ++++ G N +++R G+ +A+++V   LK  ++ ++T EEI QVATISANG+  IG+L+A AM +VGK GVITV DG T+ +ELE + GMK  RGY+SPYF+   K  K E  + L
Sbjct:   28 FYAKEVRFGPDVRSLMLQGVDILADADDVTMGPKGVNVILAKNLGPPKITKDGVTVAKGIDLKDKFQNIGARLVQNVANKTNEEAGDGTTTATVLARPIAKEGFENISRGANPIEIRKGVMLAVESVKRQLKEMSKPVNTSEEIEQVATISANGDESIGKLIAAAMNRVGKNGVITVKDGKTLEDELEIIEGMKFDRGYVSPYFINSNKGPKVEYNDAL 246          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_PSYCK2.310e-5953.8560 kDa chaperonin OS=Psychrobacter cryohalolentis ... [more]
CH60_PHOPR2.310e-5952.7860 kDa chaperonin OS=Photobacterium profundum GN=g... [more]
CH60_FRATO2.310e-5954.1760 kDa chaperonin OS=Francisella tularensis subsp.... [more]
CH60_FRATH2.310e-5954.1760 kDa chaperonin OS=Francisella tularensis subsp.... [more]
CH60_FRATF2.310e-5954.1760 kDa chaperonin OS=Francisella tularensis subsp.... [more]
CH602_PARUW2.310e-5953.0260 kDa chaperonin 2 OS=Protochlamydia amoebophila ... [more]
CH60_PSYA23.017e-5953.8560 kDa chaperonin OS=Psychrobacter arcticus (strai... [more]
CH60_PARDP3.017e-5954.4260 kDa chaperonin OS=Paracoccus denitrificans (str... [more]
CH60_PARDE3.017e-5954.4260 kDa chaperonin OS=Paracoccus denitrificans GN=g... [more]
CH63_HELVI3.941e-5951.6063 kDa chaperonin, mitochondrial OS=Heliothis vire... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top