FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_BRUSI (60 kDa chaperonin OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=groL PE=3 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 3.680e-65
Identity = 122/215 (56.74%), Postives = 165/215 (76.74%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  +E  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A++ V+++L  +A+ I+T EE+ QV TISANGE EIG+++A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEVELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGIDLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_BRUC2 (60 kDa chaperonin OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=groL PE=3 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 3.680e-65
Identity = 122/215 (56.74%), Postives = 165/215 (76.74%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  +E  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A++ V+++L  +A+ I+T EE+ QV TISANGE EIG+++A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKDVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEVELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGIDLAVNEVVAELLKKAKKINTSEEVAQVGTISANGEAEIGKMIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_AGGAC (60 kDa chaperonin OS=Aggregatibacter actinomycetemcomitans GN=groL PE=1 SV=3)

HSP 1 Score: 248.054 bits (632), Expect = 3.680e-65
Identity = 123/216 (56.94%), Postives = 165/216 (76.39%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+++V+++LK+ ++   T +EI QV TISAN +  +G+L+A+AMEKVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   EL+NP
Sbjct:    3 AKDVKFGNDARVKMLNGVNILADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVNSVVAELKNLSKPCETSKEIEQVGTISANSDSIVGQLIAQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_OCHA4 (60 kDa chaperonin OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=groL PE=3 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 4.806e-65
Identity = 123/215 (57.21%), Postives = 164/215 (76.28%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  IE  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A+  V+++L  +A+ I+T EE+ QV TISANGE EIG+++A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKDVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMLREVASKTNDTAGDGTTTATVLGQAIVQEGAKAVAAGMNPMDLKRGIDLAVTEVVAELLGKAKKINTSEEVAQVGTISANGEAEIGKMIADAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_AGRT5 (60 kDa chaperonin OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=groL PE=3 SV=2)

HSP 1 Score: 247.669 bits (631), Expect = 4.806e-65
Identity = 124/215 (57.67%), Postives = 164/215 (76.28%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AK++ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  IE  DK +++GA LV++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A+  V+ DL+++A+ I+T EE+ QV TISANGER+IG  +A AM++VG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKEVKFGRSAREKMLKGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQLVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDLAVAEVVKDLQAKAKKINTSEEVAQVGTISANGERQIGLDIAEAMQRVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH603_SINMW (60 kDa chaperonin 3 OS=Sinorhizobium medicae (strain WSM419) GN=groL3 PE=3 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 4.806e-65
Identity = 125/216 (57.87%), Postives = 160/216 (74.07%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ F   AR  ML+GV  +A AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  IE  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG K++A+G+N MDL+ GI +A+DAV+ +LKS A+ IS   EI QV TISANG+ EIG  LA AMEKVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+    + ELE+P
Sbjct:    3 AKEVKFQADARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGAKAIASGMNPMDLKRGIDLAVDAVVKELKSNARKISQNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEAKTSDTELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_RHISN (60 kDa chaperonin 2 OS=Rhizobium sp. (strain NGR234) GN=groL2 PE=3 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 4.806e-65
Identity = 123/216 (56.94%), Postives = 160/216 (74.07%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ F   AR  ML+GV  +A AVKVT+GPKGRNV+++KS G P++TKDGVTVA  IE  DK +++GA +V++VA  T+  AGDGTT ATVL QAI+ EG K+VA+G+N MDL+ G+  A+DAV+ +L+  A+ ++  +EI QV TISANG+ EIG  LA AMEKVG EGVITV +  T V ELE V GM+  RGY+SPYFVT+P   + ELE P
Sbjct:    3 AKEVRFHTEAREKMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGVDKAVDAVVEELRRNARKVTKNDEIAQVGTISANGDTEIGRFLAEAMEKVGNEGVITVEEAKTAVTELEVVEGMQFDRGYLSPYFVTNPDKMRVELEEP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_AZOC5 (60 kDa chaperonin 2 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571) GN=groL2 PE=3 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 4.806e-65
Identity = 123/216 (56.94%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ F   AR  ML+GV  +A AVKVT+GPKGRNV+IEKS G P++TKDGV+VA  IE  DK +++GA LV++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A+DA++ DL ++A+ +++  EI QV TISANG+ ++G+ LA AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+ +  + E E+P
Sbjct:    3 AKDVKFAGDAREKMLRGVDILANAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEIELEDKFENLGAQLVREVASKTNDLAGDGTTTATVLAQAIVKEGSKAVAAGMNPMDLKRGIDLAVDAIVKDLAAKAKKVTSNAEIAQVGTISANGDADVGKFLAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNAEKMRVEFEDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: HSP60_EMENI (Heat shock protein 60 OS=Emericella nidulans GN=hsp60 PE=1 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 6.277e-65
Identity = 127/244 (52.05%), Postives = 174/244 (71.31%), Query Frame = 3
Query:    6 SSISSPRCKKGVY----GRVLCNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            +S+ S   K+  +    G  L  + +  K++ FGV ARA +L+GV  +A+AV  T+GPKGRNV+IE   G+PK+TKDGVTVA +++ +DK +++GA L++ VA  TN+ AGDGTT ATVL +AI +E  K+VAAG N MDLR GI+ A++A +  L+   + I+T EEI QVATISANG+  +G+L++ AME+VGKEGVITV +G T+ +ELE   GM+  RGY SPYF+TD K QK E E PL
Sbjct:    9 TSVLSAASKRAAFTKPAGLNLQQQRFAHKELKFGVEARAQLLKGVDTLAKAVTSTLGPKGRNVLIESPYGSPKITKDGVTVAKAVQLQDKFENLGARLLQDVASKTNELAGDGTTTATVLARAIFSETVKNVAAGCNPMDLRRGIQAAVEAAVDYLQQNKRDITTGEEIAQVATISANGDTHVGKLISTAMERVGKEGVITVKEGKTLEDELEVTEGMRFDRGYTSPYFITDAKAQKVEFEKPL 252          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SHELP (60 kDa chaperonin OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=groL PE=3 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 6.277e-65
Identity = 125/216 (57.87%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  AR  ML GV+ +A AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A +++LK+ +Q  S  + I QV TISAN +  IGE++A AMEKVGKEGVITV +G  + NEL+ V GM+  RGY+SPYF+  P+T   ELENP
Sbjct:    3 AKEVLFGNDARVKMLAGVNVLANAVKVTLGPKGRNVVLDKSFGAPLITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVTEGLKAVAAGMNPMDLKRGIDKAVVAAVAELKTLSQECSDTKAIAQVGTISANSDESIGEIIATAMEKVGKEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINKPETGSVELENP 218          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_BRUSI3.680e-6556.7460 kDa chaperonin OS=Brucella suis (strain ATCC 23... [more]
CH60_BRUC23.680e-6556.7460 kDa chaperonin OS=Brucella canis (strain ATCC 2... [more]
CH60_AGGAC3.680e-6556.9460 kDa chaperonin OS=Aggregatibacter actinomycetem... [more]
CH60_OCHA44.806e-6557.2160 kDa chaperonin OS=Ochrobactrum anthropi (strain... [more]
CH60_AGRT54.806e-6557.6760 kDa chaperonin OS=Agrobacterium tumefaciens (st... [more]
CH603_SINMW4.806e-6557.8760 kDa chaperonin 3 OS=Sinorhizobium medicae (stra... [more]
CH602_RHISN4.806e-6556.9460 kDa chaperonin 2 OS=Rhizobium sp. (strain NGR23... [more]
CH602_AZOC54.806e-6556.9460 kDa chaperonin 2 OS=Azorhizobium caulinodans (s... [more]
HSP60_EMENI6.277e-6552.05Heat shock protein 60 OS=Emericella nidulans GN=hs... [more]
CH60_SHELP6.277e-6557.8760 kDa chaperonin OS=Shewanella loihica (strain AT... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top