FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_RHISN (60 kDa chaperonin 1 OS=Rhizobium sp. (strain NGR234) GN=groL1 PE=3 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 6.277e-65
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ F   AR  ML+GV  +A AVKVT+GPKGRNV+++KS G P++TKDGVTVA  +E  DK +++GA +V++VA  T+  AGDGTT ATVL QAI+ EG K+VA+G+N MDL+ GI  A+DA++ +LK+ A+ ++  +EI QV TISANG+ EIG  LA A+EKVG EGVITV +  T V ELE V GM+  RGY+SPYFVT+P   + ELE P
Sbjct:    3 AKEVRFHTDAREKMLRGVDILANAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEVELEDKFENMGAQMVREVASKTSDIAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGIDKAVDAIVEELKTNARRVTKNDEIAQVGTISANGDIEIGRFLAEAVEKVGNEGVITVEEAKTAVTELEVVEGMQFDRGYLSPYFVTNPDKMRVELEEP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_RHIEC (60 kDa chaperonin 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=groL1 PE=3 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 6.277e-65
Identity = 125/215 (58.14%), Postives = 164/215 (76.28%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AK+I FG  AR  ML+GV  +A+AVKVT+GPKGRNVII+KS G P++TKDGV+VA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A+  V+ DL+++A+ I+T EE+ QV TISANGER++G  +A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDLAVAEVVKDLQAKAKKINTSEEVAQVGTISANGERQVGLDIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ACISJ (60 kDa chaperonin OS=Acidovorax sp. (strain JS42) GN=groL PE=3 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 8.198e-65
Identity = 124/216 (57.41%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  ARA M++GV+ +A AVKVT+GPKGRNV++E+S G P VTKDGV+VA  IE +DK +++GA LVK+VA  TN  AGDGTT ATVL QAI+ EG K VAAGLN MDL+ GI  A+ A++ +LK  ++  +T +EI QV +ISAN +  +G+++A AM+KVGKEGVITV DG ++ NELE V GM+  RGY+SPYF+ +P+ Q   L+NP
Sbjct:    3 AKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKLQNMGAQLVKEVASKTNDIAGDGTTTATVLAQAIVREGSKYVAAGLNPMDLKRGIDKAVVALVEELKKASKATTTSKEIAQVGSISANSDESVGKIIADAMDKVGKEGVITVEDGKSLENELEVVEGMQFDRGYLSPYFINNPEKQAAILDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH605_RHIME (60 kDa chaperonin 5 OS=Rhizobium meliloti GN=groL5 PE=2 SV=2)

HSP 1 Score: 246.899 bits (629), Expect = 8.198e-65
Identity = 124/216 (57.41%), Postives = 160/216 (74.07%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ F   AR  ML+GV  +A AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  IE  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG K+VA+G+N MDL+ GI +A+DAV+ +LK+ A+ IS   EI QV TISANG+ EIG  LA AMEKVG EGVITV +  T   ELE V GM+  RGY+SPYF+T+    + ELE+P
Sbjct:    3 AKEVKFQTDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMLREVASRTNDLAGDGTTTATVLAQAIVREGAKAVASGMNPMDLKRGIDLAVDAVVKELKNNARKISKNSEIAQVGTISANGDTEIGRYLAEAMEKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFITNQDKMRVELEDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_SPHAL (60 kDa chaperonin 2 OS=Sphingopyxis alaskensis GN=groL2 PE=3 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 8.198e-65
Identity = 121/216 (56.02%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ F   AR  ML+GV  +A AVKVT+GPKGRNV+IEKS G P++TKDGVTVA  IE  DK +++GA ++++VA   N  AGDGTT ATVL QAI+ EG K+VAAG+N MD++ GI +A+ AV+ DL++ A+ +S   EI QVATISANG+ E+G +LA AM+KVG EGVITV +  ++  ELE+V GM+  RGY+SPYF+T+ +  K EL++P
Sbjct:    3 AKEVKFASDARDRMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELADKFENMGAQMLREVASKQNDKAGDGTTTATVLAQAIVREGSKAVAAGMNPMDVKRGIDLAVKAVVKDLETHAKKVSANSEIAQVATISANGDEEVGRILAEAMDKVGNEGVITVEEAKSLATELETVEGMQFDRGYLSPYFITNAEKLKVELDDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_RHIEC (60 kDa chaperonin 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=groL2 PE=3 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 8.198e-65
Identity = 125/216 (57.87%), Postives = 160/216 (74.07%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ F   AR  ML+GV  +A AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  IE  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG K+VA+G+N MDL+ GI +A+DAV+ +LK+ A+ IS   EI QV TISANG+ EIG  LA AMEKVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+    + ELE+P
Sbjct:    3 AKEVKFHSDARERMLRGVDVLANAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVKEGAKAVASGMNPMDLKRGIDLAVDAVVGELKANARKISNNSEIAQVGTISANGDAEIGRYLAEAMEKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNQDKMRVELEDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_GLUDA (60 kDa chaperonin 1 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=groL1 PE=3 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 8.198e-65
Identity = 122/216 (56.48%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+++KS G P++TKDGV+VA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ AV+ +LK   + I+TP E  QV TISANGE EIGE++++AM+KVG EGVITV +   +  EL+ V GM+  RGYISPYF+T+ +    +L+NP
Sbjct:    3 AKDVKFGGDARQRMLRGVDILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVSVAKEIELADKFENMGAQMVREVASKTNDVAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDKAVIAVVEELKKNTKKITTPAETAQVGTISANGEHEIGEMISQAMQKVGSEGVITVEEAKGLHTELDVVEGMQFDRGYISPYFITNAEKMVADLDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_HAES2 (60 kDa chaperonin OS=Haemophilus somnus (strain 2336) GN=groL PE=3 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 1.071e-64
Identity = 123/216 (56.94%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML GV+ +A+AVKVT+GPKGRNVI++K+ G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI++EG K+VAAG+N MDL+ GI  A++AV+ +LK  ++   T +EI QV TISAN +  +G+L+A+AMEKVGKEGVITV DG+ + +EL+ V GM+  RGY+SPYF+  P+    EL+NP
Sbjct:    3 AKDVKFGNDARVKMLAGVNVLADAVKVTLGPKGRNVILDKAFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVSEGLKAVAAGMNPMDLKRGIDKAVNAVVEELKILSKPCETSKEIEQVGTISANADETVGKLIAQAMEKVGKEGVITVEDGSGLSDELDVVEGMQFDRGYLSPYFINKPEAATVELDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_HAES1 (60 kDa chaperonin OS=Haemophilus somnus (strain 129Pt) GN=groL PE=3 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 1.071e-64
Identity = 123/216 (56.94%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML GV+ +A+AVKVT+GPKGRNVI++K+ G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI++EG K+VAAG+N MDL+ GI  A++AV+ +LK  ++   T +EI QV TISAN +  +G+L+A+AMEKVGKEGVITV DG+ + +EL+ V GM+  RGY+SPYF+  P+    EL+NP
Sbjct:    3 AKDVKFGNDARVKMLAGVNVLADAVKVTLGPKGRNVILDKAFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVSEGLKAVAAGMNPMDLKRGIDKAVNAVVEELKILSKPCETSKEIEQVGTISANADETVGKLIAQAMEKVGKEGVITVEDGSGLSDELDVVEGMQFDRGYLSPYFINKPEAATVELDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_DELAS (60 kDa chaperonin OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=groL PE=3 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 1.071e-64
Identity = 122/216 (56.48%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  ARA M++GV+ +A AVKVT+GPKGRNV++E+S G P VTKDGV+VA  IE +DK +++GA LVK+VA  TN  AGDGTT ATVL QAI+ EG K VAAGLN MDL+ GI  A+ A++ +LK +++  +T +EI QV +ISAN +  +G ++A AM+KVGKEGVITV +G ++ NEL+ V GM+  RGY+SPYF+ +P+ Q   L+NP
Sbjct:    3 AKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKLQNMGAQLVKEVASKTNDIAGDGTTTATVLAQAIVREGAKYVAAGLNPMDLKRGIDKAVAALVEELKKQSKATTTSKEIAQVGSISANSDESVGSIIAEAMDKVGKEGVITVEEGKSLANELDVVEGMQFDRGYLSPYFINNPEKQVALLDNP 218          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH601_RHISN6.277e-6556.4860 kDa chaperonin 1 OS=Rhizobium sp. (strain NGR23... [more]
CH601_RHIEC6.277e-6558.1460 kDa chaperonin 1 OS=Rhizobium etli (strain CFN ... [more]
CH60_ACISJ8.198e-6557.4160 kDa chaperonin OS=Acidovorax sp. (strain JS42) ... [more]
CH605_RHIME8.198e-6557.4160 kDa chaperonin 5 OS=Rhizobium meliloti GN=groL5... [more]
CH602_SPHAL8.198e-6556.0260 kDa chaperonin 2 OS=Sphingopyxis alaskensis GN=... [more]
CH602_RHIEC8.198e-6557.8760 kDa chaperonin 2 OS=Rhizobium etli (strain CFN ... [more]
CH601_GLUDA8.198e-6556.4860 kDa chaperonin 1 OS=Gluconacetobacter diazotrop... [more]
CH60_HAES21.071e-6456.9460 kDa chaperonin OS=Haemophilus somnus (strain 23... [more]
CH60_HAES11.071e-6456.9460 kDa chaperonin OS=Haemophilus somnus (strain 12... [more]
CH60_DELAS1.071e-6456.4860 kDa chaperonin OS=Delftia acidovorans (strain D... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top