FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH605_SINMW (60 kDa chaperonin 5 OS=Sinorhizobium medicae (strain WSM419) GN=groL5 PE=3 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 1.071e-64
Identity = 123/215 (57.21%), Postives = 163/215 (75.81%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AK++ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+I+KS G P++TKDGVTVA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A+  V+ DL ++A+ I+T +E+ QV TISANGE++IG  +A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDLAVAEVVKDLLAKAKTINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEAKTAETELEVVDGMQFDRGYLSPYFVTNPEKMVADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_MESSB (60 kDa chaperonin 1 OS=Mesorhizobium sp. (strain BNC1) GN=groL1 PE=3 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 1.071e-64
Identity = 122/215 (56.74%), Postives = 161/215 (74.88%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ F   AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G P++TKDGVTVA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ G+ +A+  V+  L   A+ I T EE+ QV TISANGE+EIG+++A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYF+T+P+    ELE+
Sbjct:    3 AKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVQEGAKAVAAGMNPMDLKRGVDLAVAEVVDYLAKAAKKIKTSEEVAQVGTISANGEKEIGQMIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFITNPEKMVAELED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PARL1 (60 kDa chaperonin OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=groL PE=3 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.398e-64
Identity = 121/218 (55.50%), Postives = 163/218 (74.77%), Query Frame = 3
Query:   72 VAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            +AK++ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+IEKS G+P+ TKDGVTVA  IE  DK +++GA +VK+VA  TN  AGDGTT ATVLTQAI+ EG KSVAAG+N MDL+ GI++A+   + D+  R++ + + +E+ QV TISANGE EIG ++A+AM +VG EGVITV +  ++  EL+ V GM+  RGY+SPYF+T+      EL+ PL
Sbjct:    1 MAKEVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIEKSFGSPRTTKDGVTVAKEIELEDKFENMGAQMVKEVASKTNDTAGDGTTTATVLTQAIVREGAKSVAAGMNPMDLKRGIEIAVRTAVEDITKRSKKVKSNDEVAQVGTISANGESEIGAMIAQAMSRVGNEGVITVEEAKSLDTELDVVEGMQFDRGYLSPYFITNADKMVVELDEPL 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_MANSM (60 kDa chaperonin OS=Mannheimia succiniciproducens (strain MBEL55E) GN=groL PE=3 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.398e-64
Identity = 123/216 (56.94%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ AV+++LK+ ++   T +EI QV TISAN +  +G+L+A+AMEKVGKEGVITV DG  + +EL+ V GM+  RGY+SPYF+  P+T   EL++P
Sbjct:    3 AKDVKFGNDARVKMLAGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVAAVVTELKALSKPCETSKEIEQVGTISANSDSIVGQLIAQAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDSP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_DIAST (60 kDa chaperonin OS=Diaphorobacter sp. (strain TPSY) GN=groL PE=3 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.398e-64
Identity = 123/216 (56.94%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  ARA M++GV+ +A AVKVT+GPKGRNV++E+S G P VTKDGV+VA  IE +DK +++GA LVK+VA  TN  AGDGTT ATVL QAI+ EG K VAAGLN MDL+ GI  A+ A++ +LK  ++  +T +EI QV +ISAN +  +G+++A AM+KVGKEGVITV DG ++ NEL+ V GM+  RGY+SPYF+ +P+ Q   L+NP
Sbjct:    3 AKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKLQNMGAQLVKEVASKTNDIAGDGTTTATVLAQAIVREGSKYVAAGLNPMDLKRGIDKAVVALVEELKKASKATTTSKEIAQVGSISANSDESVGKIIADAMDKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINNPEKQSAILDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH604_RHIME (60 kDa chaperonin 4 OS=Rhizobium meliloti GN=groL4 PE=3 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.398e-64
Identity = 123/215 (57.21%), Postives = 163/215 (75.81%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AK++ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+I+KS G P++TKDGVTVA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A+  V+ DL ++A+ I+T +E+ QV TISANGE++IG  +A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_NITWN (60 kDa chaperonin 2 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=groL2 PE=3 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.398e-64
Identity = 123/215 (57.21%), Postives = 165/215 (76.74%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FGV AR  ML+GV  +A AVKVT+GPKGRNV++EKS G P++TKDGVTVA  IE  DK +++GA +V++VA  +  AAGDGTT ATVL QAI+ EG KSVAAG+N MDL+ GI +A++AV++DL   ++ +++ EEI QV TISANG+ EIG+ LA AM+KVG EGVITV +  ++  EL+ V GM+  RGYISPYFVT+ +  + E+++
Sbjct:    3 AKDVKFGVDARDKMLRGVDILANAVKVTLGPKGRNVVLEKSFGAPRITKDGVTVAKEIELDDKFENMGAQMVREVASKSADAAGDGTTTATVLAQAIVKEGAKSVAAGMNPMDLKRGIDLAVEAVVADLSRNSKKVTSNEEIAQVGTISANGDSEIGKFLADAMKKVGNEGVITVEEAKSLETELDVVEGMQFDRGYISPYFVTNAEKMRVEMDD 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH602_ECOK1 (60 kDa chaperonin 2 OS=Escherichia coli O1:K1 / APEC GN=groL2 PE=3 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.398e-64
Identity = 121/216 (56.02%), Postives = 166/216 (76.85%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKDI FG  ARA M++GV+ +A AVK T+GPKGRNV++EKS G P +TKDGV+VA  IE  DK +++GA +VK+VA  T+  AGDGTT ATVL QA++ EG K+VAAG+N MDL+ GI  A+ + + +LK  ++  ST +EI QV +ISAN + +IGEL+A+AM+KVGKEGVITV +G+ + NEL+ V GM+  RGY+SPYF+ +P++ + ELE+P
Sbjct:    3 AKDIRFGEDARARMVRGVNVLANAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEIELADKFENMGAQMVKEVASKTSDNAGDGTTTATVLAQALIREGMKAVAAGMNPMDLKRGIDKAVTSAVEELKKISKPCSTSKEIAQVGSISANSDTDIGELIAKAMDKVGKEGVITVEEGSGLENELDVVEGMQFDRGYLSPYFINNPQSMQAELEDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_CAEEL (Chaperonin homolog Hsp-60, mitochondrial OS=Caenorhabditis elegans GN=hsp-60 PE=2 SV=2)

HSP 1 Score: 245.743 bits (626), Expect = 1.826e-64
Identity = 127/232 (54.74%), Postives = 171/232 (73.71%), Query Frame = 3
Query:   30 KKGVYGRVLCNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            +KG+   V+  R+Y AKD+ FG   R AML GV+ +A+AV VTMGPKGRNVIIE+S G+PK+TKDGVTVA SI+ +DK +++GA L++ VA   N+ AGDGTTCATVL +AI  EG +S+  G N +++R G+  A++ V+++LK  ++ ++TPEEI QVATISANG+  +G L++ AM+KVG  GVITV DG T+ +ELE + GMK  RGYISPYF+T  K  K E E  L
Sbjct:    6 RKGLQTAVV--RSY-AKDVKFGAEGRQAMLVGVNLLADAVSVTMGPKGRNVIIEQSWGSPKITKDGVTVAKSIDLKDKYQNLGAKLIQDVANKANEEAGDGTTCATVLARAIAKEGFESIRQGGNAVEIRRGVMNAVEVVVAELKKISKKVTTPEEIAQVATISANGDTVVGNLISDAMKKVGTTGVITVKDGKTLNDELELIEGMKFDRGYISPYFITSAKGAKVEYEKAL 234          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SHESW (60 kDa chaperonin OS=Shewanella sp. (strain W3-18-1) GN=groL PE=3 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 2.385e-64
Identity = 123/216 (56.94%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  AR  ML GV+ +A AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A +++LK+ +Q  +  + I QVATISAN +  IGE++A AMEKVGKEGVITV +G  + NEL+ V GM+  RGY+SPYF+  P+T   EL++P
Sbjct:    3 AKEVVFGNDARVKMLAGVNILANAVKVTLGPKGRNVVLDKSFGSPLITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVTEGLKAVAAGMNPMDLKRGIDKAVIAAVAELKALSQPCADSKAIAQVATISANSDESIGEIIATAMEKVGKEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINKPETGSVELDHP 218          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH605_SINMW1.071e-6457.2160 kDa chaperonin 5 OS=Sinorhizobium medicae (stra... [more]
CH601_MESSB1.071e-6456.7460 kDa chaperonin 1 OS=Mesorhizobium sp. (strain B... [more]
CH60_PARL11.398e-6455.5060 kDa chaperonin OS=Parvibaculum lavamentivorans ... [more]
CH60_MANSM1.398e-6456.9460 kDa chaperonin OS=Mannheimia succiniciproducens... [more]
CH60_DIAST1.398e-6456.9460 kDa chaperonin OS=Diaphorobacter sp. (strain TP... [more]
CH604_RHIME1.398e-6457.2160 kDa chaperonin 4 OS=Rhizobium meliloti GN=groL4... [more]
CH602_NITWN1.398e-6457.2160 kDa chaperonin 2 OS=Nitrobacter winogradskyi (s... [more]
CH602_ECOK11.398e-6456.0260 kDa chaperonin 2 OS=Escherichia coli O1:K1 / AP... [more]
CH60_CAEEL1.826e-6454.74Chaperonin homolog Hsp-60, mitochondrial OS=Caenor... [more]
CH60_SHESW2.385e-6456.9460 kDa chaperonin OS=Shewanella sp. (strain W3-18-... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top