FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SHEPC (60 kDa chaperonin OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=groL PE=3 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 2.385e-64
Identity = 123/216 (56.94%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  AR  ML GV+ +A AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A +++LK+ +Q  +  + I QVATISAN +  IGE++A AMEKVGKEGVITV +G  + NEL+ V GM+  RGY+SPYF+  P+T   EL++P
Sbjct:    3 AKEVVFGNDARVKMLAGVNILANAVKVTLGPKGRNVVLDKSFGSPLITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVTEGLKAVAAGMNPMDLKRGIDKAVIAAVAELKALSQPCADSKAIAQVATISANSDESIGEIIATAMEKVGKEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINKPETGSVELDHP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_HAEPS (60 kDa chaperonin OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=groL PE=3 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 2.385e-64
Identity = 123/216 (56.94%), Postives = 162/216 (75.00%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++K+ G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ AV+ +LKS ++   T +EI QV TISAN +  +G+L+A+AMEKVGKEGVITV DG  + + L+ V GM+  RGY+SPYF+  P+    ELENP
Sbjct:    3 AKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVVLDKAFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVAAVVEELKSLSKPCETSKEIEQVGTISANSDSTVGKLIAQAMEKVGKEGVITVEDGTGLEDALDVVEGMQFDRGYLSPYFINKPEAGTVELENP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_AGRVS (60 kDa chaperonin OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=groL PE=3 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 2.385e-64
Identity = 124/215 (57.67%), Postives = 163/215 (75.81%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AK+I FG  AR  ML GV  +A+AVKVT+GPKGRNVII+KS G P++TKDGV+VA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A+  V+ DL+++A+ IST EE+ QV TISANG+ ++G+ +A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKEIKFGRTAREKMLHGVDILADAVKVTLGPKGRNVIIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGNKAVAAGMNPMDLKRGIDLAVAEVVKDLQAKAKKISTSEEVAQVGTISANGDTQVGKDIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_ERYLH (60 kDa chaperonin 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=groL1 PE=3 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 2.385e-64
Identity = 122/216 (56.48%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ F   AR  ML+GV  +A AVKVT+GPKGRNV+IEKS G P++TKDGVTVA  IE +DK +++GA ++++VA   N  AGDGTT ATVL QAI+ EG K+VAAG+N +DL+ GI +A+  V+ DL+S A+ +S   EI QVATISANG+  +G  LA AM+KVG EGVITV +  ++  ELE+V GM+  RGY+SPYFVT+ +  K ELE+P
Sbjct:    3 AKEVKFASDARDRMLRGVDTLANAVKVTLGPKGRNVVIEKSFGAPRITKDGVTVAKEIELKDKFENMGAQMLREVASKQNDKAGDGTTTATVLAQAIVREGAKAVAAGMNPIDLKRGIDLAVGTVVKDLESHAKKVSANSEIAQVATISANGDETVGRFLAEAMDKVGNEGVITVEEAKSLETELETVEGMQFDRGYLSPYFVTNTEKLKVELEDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PASMU (60 kDa chaperonin OS=Pasteurella multocida GN=groL PE=3 SV=2)

HSP 1 Score: 244.973 bits (624), Expect = 3.115e-64
Identity = 122/216 (56.48%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML GV+ +A+AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI  A+ AV+++LK+ ++   T +EI QV TISAN +  +G+++A+AM+KVGKEGVITV DG  + +EL  V GM+  RGY+SPYF+  P+T   EL+NP
Sbjct:    3 AKDVKFGNDARVKMLAGVNILADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKAVTAVVTELKALSKPCETSKEIEQVGTISANSDSIVGQIIAQAMDKVGKEGVITVEDGTGLEDELAVVEGMQFDRGYLSPYFINKPETATVELDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_RHOP2 (60 kDa chaperonin 1 OS=Rhodopseudomonas palustris (strain HaA2) GN=groL1 PE=3 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 3.115e-64
Identity = 122/215 (56.74%), Postives = 164/215 (76.28%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  AR  ML+GV  +A AVKVT+GPKGRNV+IEKS G P++TKDGVTVA  IE  DK +++GA ++++VA  TN  AGDGTT ATVL QAI+ EG KSVAAG+N MDLR GI++A+ AV+ D++ RA+ +++  EI QV TISANG+  IG+++A+AM+KVG EGVITV +  ++  E++ V GMK  RGY+SPYFVT+ +    EL++
Sbjct:    3 AKDVKFGGDARDRMLRGVDILANAVKVTLGPKGRNVLIEKSFGAPRITKDGVTVAKEIELDDKFENMGAQMLREVASKTNDLAGDGTTTATVLAQAIVREGAKSVAAGMNPMDLRRGIEIAVQAVVKDIQKRARPVASSAEIAQVGTISANGDAPIGKMIAQAMQKVGNEGVITVEENKSLETEVDIVEGMKFDRGYLSPYFVTNAEKMTVELDD 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SPHWW (60 kDa chaperonin OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=groL PE=3 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 4.068e-64
Identity = 120/216 (55.56%), Postives = 164/216 (75.93%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ F   AR  +L+GV  +A+AVKVT+GPKGRNV+I+KS G P++TKDGVTVA  IE +DK +++GA LV++VA  TN  AGDGTT ATVL QAI+ EG KSVAAG+N MDL+ GI +A+  V+ +LK+R++ ++   E+ QV  ISANG++E+GE +A AM+KVGKEGVITV +   +  EL+ V GM+  RGY+SPYF+T+P+  + EL +P
Sbjct:    3 AKDVKFSRDARERILRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVTVAKEIELKDKFENIGAQLVREVASKTNDLAGDGTTTATVLAQAIVREGLKSVAAGMNPMDLKRGIDLAVTKVVENLKARSKPVAGSNEVAQVGIISANGDKEVGEKIAEAMDKVGKEGVITVEEAKGLEFELDVVEGMQFDRGYLSPYFITNPEKMQVELTDP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_ACIAC (60 kDa chaperonin OS=Acidovorax avenae subsp. citrulli (strain AAC00-1) GN=groL PE=3 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 4.068e-64
Identity = 123/216 (56.94%), Postives = 165/216 (76.39%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  ARA M++GV+ +A AVKVT+GPKGRNV++E+S G P VTKDGV+VA  IE +DK +++GA LVK+VA  T+  AGDGTT ATVL QAI+ EG K VAAGLN MDL+ GI  A+ A++++LK  ++  +T +EI QV +ISAN +  IG+++A AM+KVGKEGVITV DG ++ NEL+ V GM+  RGY+SPYF+ +P+ Q   L+NP
Sbjct:    3 AKDVVFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFGAPTVTKDGVSVAKEIELKDKLQNMGAQLVKEVASKTSDNAGDGTTTATVLAQAIVREGSKYVAAGLNPMDLKRGIDKAVTALVAELKKASKATTTSKEIAQVGSISANSDESIGKIIADAMDKVGKEGVITVEDGKSLDNELDVVEGMQFDRGYLSPYFINNPEKQAALLDNP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_SINMW (60 kDa chaperonin 1 OS=Sinorhizobium medicae (strain WSM419) GN=groL1 PE=3 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 4.068e-64
Identity = 122/215 (56.74%), Postives = 163/215 (75.81%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AK++ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A+  V+ DL ++A+ I+T +E+ QV TISANGE++IG  +A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLED 217          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH601_RHIME (60 kDa chaperonin 1 OS=Rhizobium meliloti GN=groL1 PE=2 SV=2)

HSP 1 Score: 244.588 bits (623), Expect = 4.068e-64
Identity = 122/215 (56.74%), Postives = 163/215 (75.81%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AK++ FG  AR  ML+GV  +A+AVKVT+GPKGRNV+I+KS G P++TKDGV+VA  IE  DK +++GA +V++VA  TN  AGDGTT ATVL QAI+ EG K+VAAG+N MDL+ GI +A+  V+ DL ++A+ I+T +E+ QV TISANGE++IG  +A AM+KVG EGVITV +  T   ELE V GM+  RGY+SPYFVT+P+    +LE+
Sbjct:    3 AKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFGAPRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGAKAVAAGMNPMDLKRGIDLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLED 217          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_SHEPC2.385e-6456.9460 kDa chaperonin OS=Shewanella putrefaciens (stra... [more]
CH60_HAEPS2.385e-6456.9460 kDa chaperonin OS=Haemophilus parasuis serovar ... [more]
CH60_AGRVS2.385e-6457.6760 kDa chaperonin OS=Agrobacterium vitis (strain S... [more]
CH601_ERYLH2.385e-6456.4860 kDa chaperonin 1 OS=Erythrobacter litoralis (st... [more]
CH60_PASMU3.115e-6456.4860 kDa chaperonin OS=Pasteurella multocida GN=groL... [more]
CH601_RHOP23.115e-6456.7460 kDa chaperonin 1 OS=Rhodopseudomonas palustris ... [more]
CH60_SPHWW4.068e-6455.5660 kDa chaperonin OS=Sphingomonas wittichii (strai... [more]
CH60_ACIAC4.068e-6456.9460 kDa chaperonin OS=Acidovorax avenae subsp. citr... [more]
CH601_SINMW4.068e-6456.7460 kDa chaperonin 1 OS=Sinorhizobium medicae (stra... [more]
CH601_RHIME4.068e-6456.7460 kDa chaperonin 1 OS=Rhizobium meliloti GN=groL1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top