FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH2_ARATH (Adenosylhomocysteinase 2 OS=Arabidopsis thaliana GN=SAHH2 PE=1 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.079e-83
Identity = 148/186 (79.57%), Postives = 161/186 (86.56%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGLK 637
            MAL V+K++SGRE+KVKD+SQADFGRLEIELAEVEMPGL++C  EFGPSQP KGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEI+ K G  PDP STD  EFQIVL+II+DGL+
Sbjct:    1 MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDGLQ 186          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_SOLLC (Adenosylhomocysteinase OS=Solanum lycopersicum GN=SAHH PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 3.470e-82
Identity = 148/186 (79.57%), Postives = 158/186 (84.95%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGLK 637
            MAL V+K+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMA RAEFGPSQP KGAKIT SLHMTIQTA LIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP STD  EFQ+VLTII++ LK
Sbjct:    1 MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPVKGAKITCSLHMTIQTAFLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTVPDPTSTDNVEFQLVLTIIKESLK 186          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_STRGG (Adenosylhomocysteinase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=ahcY PE=3 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 2.591e-53
Identity = 106/181 (58.56%), Postives = 127/181 (70.17%), Query Frame = 2
Query:  113 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW--GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTII 622
            ++FKV DLS A FGR EI LAE EMPGLM+ R EF  +QP  GA+ITGSLHMT+QTAVLIETL ALGAEVRW SCNIFSTQDH                       WKGETL+EYWWCTE+AL W   P GGP++I+DDGGDATLL+H+GV+    +EK G  PDP++ D  E+  +LT++
Sbjct:    8 QDFKVADLSLAPFGRKEITLAEHEMPGLMSIRKEFAAAQPLAGARITGSLHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAVGPNGTPEAPAGVPVFAWKGETLEEYWWCTEQALTWPNTPTGGPNMILDDGGDATLLVHKGVE----FEKAGAAPDPSTADSEEYAHILTLL 184          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_STRAW (Adenosylhomocysteinase OS=Streptomyces avermitilis GN=ahcY PE=3 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.422e-51
Identity = 102/181 (56.35%), Postives = 127/181 (70.17%), Query Frame = 2
Query:  113 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW--GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTII 622
            ++FKV DLS A+FGR EI LAE EMPGLM+ R E+  +QP  GA++TGSLHMT+QTAVLIETL ALGAEVRW SCNIFSTQDH                       WKGETL+EYWWCTE+AL W   P GGP++I+DDGGDATLL+H+GV+    YEK GK+P   + +  E +++L ++
Sbjct:    8 QDFKVADLSLAEFGRKEITLAEHEMPGLMSIRKEYAEAQPLAGARVTGSLHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAVGPNGTPDNPQGVPVFAWKGETLEEYWWCTEQALTWPNTPTGGPNMILDDGGDATLLVHKGVE----YEKDGKVPSVDTAESDEHRVILELL 184          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_STRCO (Adenosylhomocysteinase OS=Streptomyces coelicolor GN=ahcY PE=3 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.857e-51
Identity = 103/181 (56.91%), Postives = 126/181 (69.61%), Query Frame = 2
Query:  113 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW--GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTII 622
            ++FKV DLS A FGR EI LAE EMPGLMA R E+  +QP  GA++TGSLHMT+QTAVLIETL ALGAEVRW SCNIFSTQDH                       WKGETL+EYWWCTE+AL W   P GGP++I+DDGGDATLL+H+GV+    YEK GK+P   + +  E +++L ++
Sbjct:    8 QDFKVADLSLAAFGRKEITLAEHEMPGLMAIRKEYAEAQPLAGARVTGSLHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAVGPNGTPDNPQGVPVFAWKGETLEEYWWCTEQALTWPNTPTGGPNMILDDGGDATLLVHKGVE----YEKDGKVPSVDTAESDEHRVILELL 184          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_STRAZ (Adenosylhomocysteinase OS=Streptomyces atroolivaceus GN=ahcY PE=3 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.857e-51
Identity = 104/180 (57.78%), Postives = 125/180 (69.44%), Query Frame = 2
Query:   95 QKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGL 634
            Q  A   +FKV DLS A FGR EI LAE EMPGLM+ R E+  +QP  GA+ITGSLHMT+QTAVLIETL ALGA+VRW SCNI+STQDH              WKGETL+EYWWCTE+AL W    GP++I+DDGGDATLL+H+GV+    Y KTG LP+  + + A  + +L   R GL
Sbjct:    4 QPPADFTDFKVADLSLAAFGRKEITLAEHEMPGLMSIREEYAAAQPLAGARITGSLHMTVQTAVLIETLVALGADVRWVSCNIYSTQDHAAAAIAAAGIPVFAWKGETLEEYWWCTEQALTWPGHTGPNMILDDGGDATLLVHKGVE----YRKTGILPEAENEELAVVRALLD--RSGL 177          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_STRAA (Adenosylhomocysteinase OS=Streptomyces argillaceus GN=ahcY PE=3 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 5.403e-51
Identity = 102/185 (55.14%), Postives = 127/185 (68.65%), Query Frame = 2
Query:  101 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW--GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTII 622
            SA   +FKV DLS A+FGR EI LAE EMPGLM+ R E+  +QP  GA++TGSLHMT+QTAVLIETL ALGA+VRW SCNIFSTQ H                       WKGETL+EYWWCTE+AL W   P GGP++I+DDGGDATLL+H+GV+    YEK GK+P   + +  E +++L ++
Sbjct:    2 SADFTDFKVADLSLAEFGRKEITLAEHEMPGLMSIRREYAEAQPLAGARVTGSLHMTVQTAVLIETLVALGAQVRWASCNIFSTQGHAAAAIAVGPDGTPDNPRAVPVFAWKGETLEEYWWCTEQALTWPDSPTGGPNMILDDGGDATLLVHKGVE----YEKDGKVPSVDTAENDEHRVILELL 182          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_DESAD (Adenosylhomocysteinase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=ahcY PE=3 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 2.053e-50
Identity = 103/173 (59.54%), Postives = 121/173 (69.94%), Query Frame = 2
Query:   98 KSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVL 613
            K  S  ++KV D+S AD+G  E++L+E EMPGLM+ R ++G  +P KG K+ GSLHMTIQTA+LIETL ALGA++RW SCNIFSTQDH               WKGETL+EYWWCTE+AL W  G GPDLIVDDGGDATLLIH GVKA    EK   + D   TD  EFQ VL
Sbjct:    3 KVDSKLDYKVADISLADWGNKEMQLSEREMPGLMSIREKYGKEKPLKGLKVMGSLHMTIQTAMLIETLHALGADIRWASCNIFSTQDHAAAAIAANGTAKVFAWKGETLEEYWWCTEQALTWPDGSGPDLIVDDGGDATLLIHHGVKA----EKDASILD-EKTDNKEFQCVL 170          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PLAF7 (Adenosylhomocysteinase OS=Plasmodium falciparum (isolate 3D7) GN=PFE1050w PE=1 SV=2)

HSP 1 Score: 197.978 bits (502), Expect = 3.502e-50
Identity = 93/174 (53.45%), Postives = 122/174 (70.11%), Query Frame = 2
Query:  122 KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPG--GGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGL 634
            KVKD+S A FG++++E++E EMPGLM  R E+G  QP K AKITG LHMT++ A+LIETL  LGA++RWCSCNI+ST D+               WK ETL+EYWWC E AL WG G   GPD+IVDDGGDATLL+H+GV+ E++YE+   LPDP      E +  LT++++ +
Sbjct:    7 KVKDISLAPFGKMQMEISENEMPGLMRIREEYGKDQPLKNAKITGCLHMTVECALLIETLQKLGAQIRWCSCNIYSTADYAAAAVSTLENVTVFAWKNETLEEYWWCVESALTWGDGDDNGPDMIVDDGGDATLLVHKGVEYEKLYEEKNILPDPEKAKNEEERCFLTLLKNSI 180          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PLAYO (Adenosylhomocysteinase OS=Plasmodium yoelii yoelii GN=PY02893 PE=3 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 4.574e-50
Identity = 95/173 (54.91%), Postives = 122/173 (70.52%), Query Frame = 2
Query:  122 KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGG-GPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGL 634
            K+KDLS A FG+L++E++E EMPG+M  R E+   +PFKGAKITG LHMTI+TA+LIETL  LGA +RWCSCNIFST D+               W+GETL+EYWWC EKAL WG  G GPDLIVDDG DA+ L+H+G + E++YE+   LPDP S    E +  L++I+  +
Sbjct:    7 KIKDLSLAPFGKLQMEISETEMPGIMTIREEYEKLKPFKGAKITGCLHMTIETALLIETLQKLGARIRWCSCNIFSTLDYAAAAVSTLENVSVFAWRGETLEEYWWCVEKALTWGENGEGPDLIVDDGADASYLVHKGAEYEKLYEEKKILPDPESGKNEEERCFLSLIKSSI 179          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH2_ARATH1.079e-8379.57Adenosylhomocysteinase 2 OS=Arabidopsis thaliana G... [more]
SAHH_SOLLC3.470e-8279.57Adenosylhomocysteinase OS=Solanum lycopersicum GN=... [more]
SAHH_STRGG2.591e-5358.56Adenosylhomocysteinase OS=Streptomyces griseus sub... [more]
SAHH_STRAW1.422e-5156.35Adenosylhomocysteinase OS=Streptomyces avermitilis... [more]
SAHH_STRCO1.857e-5156.91Adenosylhomocysteinase OS=Streptomyces coelicolor ... [more]
SAHH_STRAZ1.857e-5157.78Adenosylhomocysteinase OS=Streptomyces atroolivace... [more]
SAHH_STRAA5.403e-5155.14Adenosylhomocysteinase OS=Streptomyces argillaceus... [more]
SAHH_DESAD2.053e-5059.54Adenosylhomocysteinase OS=Desulfovibrio salexigens... [more]
SAHH_PLAF73.502e-5053.45Adenosylhomocysteinase OS=Plasmodium falciparum (i... [more]
SAHH_PLAYO4.574e-5054.91Adenosylhomocysteinase OS=Plasmodium yoelii yoelii... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top