FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_AZOSE (Adenosylhomocysteinase OS=Azoarcus sp. (strain EbN1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.688e-42
Identity = 86/143 (60.14%), Postives = 102/143 (71.33%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            ++ V DL+ A +GR EI +AE EMPGLMA R EF   QP KGA+ITGSLHMTIQTAVLIETLTALGAEVRW SCNIFSTQDH               KGE+L +YW  T +  +W  GG  ++I+DDGGDATLL+H G +AE+
Sbjct:   10 DYVVADLALAGWGRKEIRIAETEMPGLMAIREEFAVVQPLKGARITGSLHMTIQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAIAASGVPVFAVKGESLADYWDYTHRIFEWRDGGYSNMILDDGGDATLLLHLGARAEK 152          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_POLSQ (Adenosylhomocysteinase OS=Polynucleobacter sp. (strain QLW-P1DMWA-1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 3.510e-42
Identity = 83/140 (59.29%), Postives = 101/140 (72.14%), Query Frame = 2
Query:  125 VKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            + D+S +DFGR EI +AE EMPGL+A R EF   QP +GA+ITGSLHMTIQTAVLIETL ALGAEV+W SCNIFSTQDH               KGETL++YW  T +  +W  GG  ++I+DDGGDATLL+H G +AE+
Sbjct:   17 IADISLSDFGRKEIAIAETEMPGLIAIRDEFAAQQPLRGARITGSLHMTIQTAVLIETLEALGAEVQWASCNIFSTQDHAAAAIAANGTPVFAIKGETLEQYWDFTHRIFEWADGGYTNMILDDGGDATLLLHLGARAEK 156          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_SYNS9 (Adenosylhomocysteinase OS=Synechococcus sp. (strain CC9902) GN=ahcY PE=3 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 4.585e-42
Identity = 83/145 (57.24%), Postives = 103/145 (71.03%), Query Frame = 2
Query:  110 GREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            G +  + D++ A FGR E+++AE EMPGLMA RA++G  +P KGA+I GSLHMTIQTAVLIETL  LGA+VRW SCNIFSTQDH               KGETL+EYW  T + L+W  GG P++I+DDGGDAT L+  G KAE+
Sbjct:   14 GTDCVIADINLAAFGRKELDIAETEMPGLMALRAKYGNEKPLKGARIAGSLHMTIQTAVLIETLEELGADVRWASCNIFSTQDHAAAAIAANGTPVFAVKGETLEEYWAYTHRILEWSDGGAPNMILDDGGDATGLVILGTKAEQ 158          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PROMM (Adenosylhomocysteinase OS=Prochlorococcus marinus (strain MIT 9313) GN=ahcY PE=3 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 4.585e-42
Identity = 83/142 (58.45%), Postives = 100/142 (70.42%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            ++ V D+  ADFGR E+ +AE EMPGL+A R ++G  +P KGA+I GSLHMTIQT VLIETL ALGA+VRW SCNIFSTQDH               KGETL EYW  T + L+WG GG P++I+DDGGDAT L+  G KAE
Sbjct:   16 QYVVADIDLADFGRKELSIAETEMPGLIALRIKYGSEKPLKGARIAGSLHMTIQTGVLIETLVALGADVRWASCNIFSTQDHAAAAIAASGVPVFATKGETLDEYWAYTHRILEWGDGGTPNMILDDGGDATGLVMLGSKAE 157          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_POLNS (Adenosylhomocysteinase OS=Polynucleobacter necessarius (strain STIR1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 4.585e-42
Identity = 83/140 (59.29%), Postives = 100/140 (71.43%), Query Frame = 2
Query:  125 VKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            + D+S ADFGR EI +AE EMPGL+A R EF   QP +G +ITGSLHMTIQTAVLIETL ALGAEV+W SCNIFSTQDH               KGETL++YW  T +  +W  GG  ++I+DDGGDATLL+H G +AE+
Sbjct:   17 IADISLADFGRKEIAIAETEMPGLIAIRDEFAAQQPLRGTRITGSLHMTIQTAVLIETLEALGAEVQWASCNIFSTQDHAAAAIAANGTPVFAIKGETLEQYWDFTHRIFEWADGGYTNMILDDGGDATLLLHLGARAEK 156          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_DIAST (Adenosylhomocysteinase OS=Diaphorobacter sp. (strain TPSY) GN=ahcY PE=3 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 4.585e-42
Identity = 87/144 (60.42%), Postives = 103/144 (71.53%), Query Frame = 2
Query:  125 VKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGP----GGGPDLIVDDGGDATLLIHEGVKAEE 544
            + D+S A++GR EI +AE EMPGLMA R EF   QP KGA+ITGSLHMTIQTAVLIETL ALGA+VRW SCNIFSTQDH               KGETL +YW  T +  D+GP    G GP++I+DDGGDATLL+H G +AE+
Sbjct:   13 IADISLAEWGRKEIRIAETEMPGLMAIREEFAAKQPLKGARITGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAATGTPVFAIKGETLVDYWDYTHRIFDFGPKGSEGEGPNMILDDGGDATLLMHLGKRAEK 156          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BORPD (Adenosylhomocysteinase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=ahcY PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 5.988e-42
Identity = 84/143 (58.74%), Postives = 100/143 (69.93%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            ++ V D+S A +GR E+ +AE EMPGLMA R EF  SQP KGA+I GSLHMTIQT VLIETL ALGAEVRW SCNIFSTQDH               KGETL+EYW  T +  +W  G   ++I+DDGGDATLL+H G +AE+
Sbjct:   11 DYHVADMSLAAWGRRELAIAETEMPGLMAIREEFAASQPLKGARIAGSLHMTIQTGVLIETLVALGAEVRWASCNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWQYTHRIFEWPEGRHANMILDDGGDATLLLHLGARAEQ 153          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_LEPCP (Adenosylhomocysteinase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ahcY PE=3 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 7.820e-42
Identity = 86/153 (56.21%), Postives = 106/153 (69.28%), Query Frame = 2
Query:   98 KSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGG----GPDLIVDDGGDATLLIHEGVKAEE 544
            K+    ++ V DLS A +GR EI +AE EMPGLMA R EF   QP KGA++TGSLHMTIQTAVL+ETL ALGA+VRW SCNIFSTQDH              +KGETL +YW  T +  ++G  G    GP++I+DDGGDATLL+H G +AE+
Sbjct:    6 KALHENDYLVADLSLAAWGRKEIRIAETEMPGLMAIREEFAAKQPLKGARVTGSLHMTIQTAVLVETLQALGAQVRWASCNIFSTQDHAAAALAVQGTPVFAYKGETLADYWDYTHRIFEFGAAGTDGEGPNMILDDGGDATLLMHLGKRAEK 158          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_RHILO (Adenosylhomocysteinase OS=Rhizobium loti GN=ahcY PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.021e-41
Identity = 81/143 (56.64%), Postives = 103/143 (72.03%), Query Frame = 2
Query:  113 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +++ V D+S A +GR E+++AE EMPGLMACR EFG  +P KGA+ITGSLHMTIQTAVLIETL ALGA++RW SCNIFSTQDH               KGE+L++YW  T++   W  GG  ++I+DDGGDAT+ I  G +AE
Sbjct:    5 KDYVVADISLAGWGRKELDIAETEMPGLMACREEFGAKKPLKGARITGSLHMTIQTAVLIETLKALGADIRWASCNIFSTQDHAAAAIAEAGIPVFAVKGESLEQYWDYTDRIFQWADGGLSNMILDDGGDATMYILIGARAE 147          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_TRIVA (Adenosylhomocysteinase OS=Trichomonas vaginalis PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.334e-41
Identity = 91/187 (48.66%), Postives = 115/187 (61.50%), Query Frame = 2
Query:   98 KSASGR--EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQD---------HXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIR 625
            KS +G   E+++ D++    GR E+ LAE EMPGLM  R  +  S+P KG +I+GSLHMT+QTAVLIETLTALGA+VRW SCNIFSTQD                        WKGETL EYW  T +AL W  G GP  +VDDGGDATLLI +G +    +E  G +P+P   D  E++ VL  ++
Sbjct:    4 KSPAGAPFEYRIADINLHVLGRKELTLAEKEMPGLMVLRERYSASKPLKGVRISGSLHMTVQTAVLIETLTALGADVRWASCNIFSTQDTAAAAIVVGPTGTPEKPAGIPVFAWKGETLPEYWENTYRALTWPDGQGPQQVVDDGGDATLLISKGFE----FETAGAVPEPTEADNLEYRCVLATLK 186          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_AZOSE2.688e-4260.14Adenosylhomocysteinase OS=Azoarcus sp. (strain EbN... [more]
SAHH_POLSQ3.510e-4259.29Adenosylhomocysteinase OS=Polynucleobacter sp. (st... [more]
SAHH_SYNS94.585e-4257.24Adenosylhomocysteinase OS=Synechococcus sp. (strai... [more]
SAHH_PROMM4.585e-4258.45Adenosylhomocysteinase OS=Prochlorococcus marinus ... [more]
SAHH_POLNS4.585e-4259.29Adenosylhomocysteinase OS=Polynucleobacter necessa... [more]
SAHH_DIAST4.585e-4260.42Adenosylhomocysteinase OS=Diaphorobacter sp. (stra... [more]
SAHH_BORPD5.988e-4258.74Adenosylhomocysteinase OS=Bordetella petrii (strai... [more]
SAHH_LEPCP7.820e-4256.21Adenosylhomocysteinase OS=Leptothrix cholodnii (st... [more]
SAHH_RHILO1.021e-4156.64Adenosylhomocysteinase OS=Rhizobium loti GN=ahcY P... [more]
SAHH_TRIVA1.334e-4148.66Adenosylhomocysteinase OS=Trichomonas vaginalis PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top