FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PROMA (Adenosylhomocysteinase OS=Prochlorococcus marinus GN=ahcY PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 4.291e-40
Identity = 83/154 (53.90%), Postives = 102/154 (66.23%), Query Frame = 2
Query:   83 ALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            A S  +     +F V D++ ADFGR E+ +AE EMPGLM+ R ++G  +P +GA+I GSLHMTIQT VLIETL ALGA+VRW SCNIFSTQDH               KGETL EYW  T   L+W    GP++I+DDGGDAT L+  G KAE+
Sbjct:    5 AASTSQVVGDSDFVVADITLADFGRKELAIAEKEMPGLMSLRDKYGQEKPLQGARIAGSLHMTIQTGVLIETLVALGAQVRWASCNIFSTQDHAAAAIAKAGVPVFAKKGETLSEYWSFTHSILEWSGEQGPNMILDDGGDATGLVILGSKAEK 158          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_DELAS (Adenosylhomocysteinase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 4.291e-40
Identity = 87/159 (54.72%), Postives = 108/159 (67.92%), Query Frame = 2
Query:  125 VKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGG----GPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTD 589
            + D+S A +GR EI +AE EMPGLMA R EF  +QP KGA+I GSLHMTIQTAVLIETL ALGAEVRW SCNIFSTQDH               KGE+L +YW  T +  ++G  G    GP++I+DDGGDAT+L+H G++AE   +    L +PAS +
Sbjct:   14 IADISLAAWGRKEILIAETEMPGLMATREEFAAAQPLKGARIAGSLHMTIQTAVLIETLKALGAEVRWASCNIFSTQDHAAAAIAETGTPVFAIKGESLADYWDYTHRIFEFGAAGTEGEGPNMILDDGGDATMLLHLGMRAE---KDLSVLDNPASEE 169          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_CHRVO (Adenosylhomocysteinase OS=Chromobacterium violaceum GN=ahcY PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 4.291e-40
Identity = 81/143 (56.64%), Postives = 101/143 (70.63%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            +F V D++ A +GR E+ +AE EMPGLMA R E+  +QP +GA+I GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH              +KGE+L EYW  + K  +W  G   ++I+DDGGDATLL+  G KAE+
Sbjct:    6 DFHVADIALAGWGRKELNIAETEMPGLMATRDEYHAAQPLRGARIAGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAIAAAGIPVFAFKGESLDEYWEFSHKIFEWPEGQPANMILDDGGDATLLLMLGSKAEK 148          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_CANAL (Adenosylhomocysteinase OS=Candida albicans GN=SAH1 PE=1 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 4.291e-40
Identity = 90/163 (55.21%), Postives = 106/163 (65.03%), Query Frame = 2
Query:  101 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKAL-DWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPAST 586
            SA    +KV D+S A FGR +IEL+E EMPGLM  R ++GPSQP KGA+I G LHMTIQTAVLIETL ALGAEV W SCNIFSTQDH              WKGET +EY WC E+ L  +  G   +LI+DDGGD T L+HE  K  E+ E    L +  +T
Sbjct:    3 SAPATNYKVADISLAAFGRKDIELSENEMPGLMYIRKKYGPSQPLKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIFSTQDHAAAAIAAAGVPVFAWKGETEEEYQWCIEQQLFAFKDGKKLNLILDDGGDLTSLVHE--KYPEMLEDCYGLSEETTT 163          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BURPP (Adenosylhomocysteinase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ahcY PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 5.604e-40
Identity = 83/155 (53.55%), Postives = 105/155 (67.74%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            M  +V  S + ++F V D+S AD+GR E+ +AE EMPGL+  R E+   QP KGA+I GSLHMTIQT VLIETLTALGA+VRW SCNIFSTQDH              +KGE+L EYW  + +  +W  G   ++I+DDGGDATLL+  G KAE+
Sbjct:    1 MNAAVIDSKNSQDFVVADMSLADWGRKELNIAETEMPGLVQTREEYKAQQPLKGARIAGSLHMTIQTGVLIETLTALGADVRWASCNIFSTQDHAAAAIAKAGTPVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEK 155          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BURXL (Adenosylhomocysteinase OS=Burkholderia xenovorans (strain LB400) GN=ahcY PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 9.559e-40
Identity = 83/155 (53.55%), Postives = 105/155 (67.74%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            M  +V  S + ++F V D+S AD+GR E+ +AE EMPGL+  R E+   QP KGA+I GSLHMTIQT VLIETLTALGA+VRW SCNIFSTQDH              +KGE+L EYW  + +  +W  G   ++I+DDGGDATLL+  G KAE+
Sbjct:    1 MNAAVIDSKNSQDFIVADMSLADWGRKELNIAETEMPGLVQTREEYKVQQPLKGARIAGSLHMTIQTGVLIETLTALGADVRWASCNIFSTQDHAAAAIAKAGTPVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEK 155          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PROM9 (Adenosylhomocysteinase OS=Prochlorococcus marinus (strain MIT 9312) GN=ahcY PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.248e-39
Identity = 86/155 (55.48%), Postives = 103/155 (66.45%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            M ++    +S   + V D+S +DFGR EI++AE EMPGLMA R ++   +P KGAKI GSLHMTIQTAVLIETL  LGAEV+W SCNIFSTQDH               KGETL EYW  T   LDWG    P++I+DDGGDAT L+  G KAE+
Sbjct:    1 MVIANSVKSSTTNYVVADISLSDFGRKEIKIAETEMPGLMALRDKYQSEKPLKGAKIAGSLHMTIQTAVLIETLVDLGAEVKWASCNIFSTQDHAAAAIADQGISVYAKKGETLDEYWQYTHCILDWG-ADSPNMILDDGGDATGLLILGSKAEK 154          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PROM2 (Adenosylhomocysteinase OS=Prochlorococcus marinus (strain MIT 9215) GN=ahcY PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.248e-39
Identity = 86/155 (55.48%), Postives = 102/155 (65.81%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            M +S     S   F + D+S +DFGR EI++AE EMPGLMA R ++   +P KGAKI GSLHMTIQTAVLIETL  LGA+V+W SCNIFSTQDH               KGETL EYW  T   LDWG    P++I+DDGGDAT L+  G KAE+
Sbjct:    1 MVISNSIKTSVPHFVISDISLSDFGRKEIKIAETEMPGLMALRDKYQSEKPLKGAKIAGSLHMTIQTAVLIETLVDLGAQVKWASCNIFSTQDHAAAAIADRGIPVFAKKGETLDEYWQYTHYILDWG-SDSPNMILDDGGDATGLLILGSKAEK 154          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_ZYMMO (Adenosylhomocysteinase OS=Zymomonas mobilis GN=ahcY PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.631e-39
Identity = 85/160 (53.12%), Postives = 104/160 (65.00%), Query Frame = 2
Query:  125 VKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQ 604
            V+D+S A +GR EI++AE EMPGLMA R E+   +P KGA+ITGSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH               KGE+L+EYW   ++  DWG G   ++I+DDGGDAT+ +  G K E   E     P P + +   FQ
Sbjct:    8 VRDISLAGWGRKEIDIAEGEMPGLMALREEYAAKKPLKGARITGSLHMTIQTAVLIETLVDLGAEVRWASCNIFSTQDHAAAAIAEQNIPVFAVKGESLEEYWDYVDRIFDWGKGETANMILDDGGDATMFVLWGAKLEAGVE----FPAPQNEEEEIFQ 163          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_SCHPO (Adenosylhomocysteinase OS=Schizosaccharomyces pombe GN=SPBC8D2.18c PE=2 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.631e-39
Identity = 81/139 (58.27%), Postives = 97/139 (69.78%), Query Frame = 2
Query:  113 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGP-DLIVDDGGDATLLIHE 526
            + +KV D+S A FGR E+E+AE EMPGL+A R ++  SQP KGA+I G LHMTIQTAVLIETL ALGAEV W SCNI+STQDH              WKGET +EY WC E+ L   P G P ++I+DDGGD T L+HE
Sbjct:    4 QNYKVADISLAAFGRKELEIAENEMPGLIAVREKYAKSQPLKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAATGVPVFAWKGETEEEYLWCIEQQLKSFPSGKPLNMILDDGGDLTALVHE 142          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_PROMA4.291e-4053.90Adenosylhomocysteinase OS=Prochlorococcus marinus ... [more]
SAHH_DELAS4.291e-4054.72Adenosylhomocysteinase OS=Delftia acidovorans (str... [more]
SAHH_CHRVO4.291e-4056.64Adenosylhomocysteinase OS=Chromobacterium violaceu... [more]
SAHH_CANAL4.291e-4055.21Adenosylhomocysteinase OS=Candida albicans GN=SAH1... [more]
SAHH_BURPP5.604e-4053.55Adenosylhomocysteinase OS=Burkholderia phytofirman... [more]
SAHH_BURXL9.559e-4053.55Adenosylhomocysteinase OS=Burkholderia xenovorans ... [more]
SAHH_PROM91.248e-3955.48Adenosylhomocysteinase OS=Prochlorococcus marinus ... [more]
SAHH_PROM21.248e-3955.48Adenosylhomocysteinase OS=Prochlorococcus marinus ... [more]
SAHH_ZYMMO1.631e-3953.13Adenosylhomocysteinase OS=Zymomonas mobilis GN=ahc... [more]
SAHH_SCHPO1.631e-3958.27Adenosylhomocysteinase OS=Schizosaccharomyces pomb... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top