FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PROM0 (Adenosylhomocysteinase OS=Prochlorococcus marinus (strain MIT 9301) GN=ahcY PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.631e-39
Identity = 86/155 (55.48%), Postives = 103/155 (66.45%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            M ++     S  +F + D+S +DFGR EI++AE EMPGLMA R ++   +P KGAKI GSLHMTIQTAVLIETL  LGAEV+W SCNIFSTQDH               KGETL EYW  T   LDWG    P++I+DDGGDAT L+  G KAE+
Sbjct:    1 MVIANSVKTSTPKFIISDISLSDFGRKEIKIAETEMPGLMALRDKYQSEKPLKGAKIAGSLHMTIQTAVLIETLVDLGAEVKWASCNIFSTQDHAAAAIADQGISVFAKKGETLDEYWQYTHYILDWG-SDFPNMILDDGGDATGLLILGSKAEK 154          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_CORDI (Adenosylhomocysteinase OS=Corynebacterium diphtheriae GN=ahcY PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.631e-39
Identity = 88/182 (48.35%), Postives = 111/182 (60.99%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGL 634
            ++ VKDLS A+ GR +I LAE EMPGLM  R E+   QP  GA+ITGS+HMT+QTAVLIETL ALGA+VRW SCNIFSTQD                        WKGETL+EYW C +K   WG    P++I+DDGGDAT+ +  G +    +E+ G +P     D  E+Q  L ++R  L
Sbjct:    5 DYNVKDLSLAEAGRHQIRLAEYEMPGLMQLREEYQQEQPLAGARITGSIHMTVQTAVLIETLVALGAQVRWASCNIFSTQDEAAAAVVVGPHGTPEDPQGVPVFAWKGETLEEYWDCVDKIFSWG-DELPNMILDDGGDATMAVIRGKQ----FEEAGMVPPVEEGDSDEYQAFLGMLRKTL 181          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_DROME (Adenosylhomocysteinase OS=Drosophila melanogaster GN=Ahcy13 PE=1 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 2.781e-39
Identity = 78/136 (57.35%), Postives = 98/136 (72.06%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE 526
            +KV D+S A++GR  I +AE EMPGLMACR ++GPS+P KGA+ITG LHMT+QTAVLIETL  LGA+V+W SCNIFSTQD+              WKGET +EY WC E+ L +  G   ++I+DDGGD T L+HE
Sbjct:    6 YKVADISLAEWGRKAIIIAENEMPGLMACRKKYGPSKPLKGARITGCLHMTVQTAVLIETLVELGAQVQWSSCNIFSTQDNAAAAIAATGVPVYAWKGETDEEYMWCIEQTLVFPDGQPLNMILDDGGDLTNLVHE 141          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BURP8 (Adenosylhomocysteinase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ahcY PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.781e-39
Identity = 82/155 (52.90%), Postives = 104/155 (67.10%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            M  +V  S   ++F V DLS AD+GR E+++AE EMPGL+  R E+   QP KGA++ GSLHMTIQT VLIETL ALGA+VRW SCNIFSTQDH              +KGE+L EYW  + +  +W  G   ++I+DDGGDATLL+  G KAE+
Sbjct:    1 MNAAVIDSKHSQDFIVADLSLADWGRKELDIAETEMPGLVQIREEYKAQQPLKGARVAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIAKGGTPVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEK 155          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_NOVAD (Adenosylhomocysteinase OS=Novosphingobium aromaticivorans (strain DSM 12444) GN=ahcY PE=3 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 4.744e-39
Identity = 83/142 (58.45%), Postives = 95/142 (66.90%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            ++ V D+  ADFGR EI +AE EMPGLMA R EFG SQP KGA+ITGSLHMTIQTAVLIETL ALGAEVRW +CNIFSTQDH               KGE+L EYW       DWG     ++I+DDGGDAT+    G + E
Sbjct:   10 DYVVADIGLADFGRAEIRIAETEMPGLMALREEFGASQPLKGARITGSLHMTIQTAVLIETLVALGAEVRWATCNIFSTQDHAAAAIAAAGIPVFAVKGESLAEYWDYVGSIFDWGDQTA-NMILDDGGDATMFALWGARVE 150          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_LEIDO (Adenosylhomocysteinase OS=Leishmania donovani PE=3 SV=2)

HSP 1 Score: 160.999 bits (406), Expect = 4.744e-39
Identity = 81/136 (59.56%), Postives = 97/136 (71.32%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGG-PDLIVDDGGDATLLI 520
            ++KVKD+S A++GR  IELAE EMPGLM  R E+GPSQP KGAKI G LHMT+QTAVLIETL ALGA+VRW SCNIFSTQD+              WKGET +EY WC  + +    G G P++I+DDGGD T L+
Sbjct:    3 DYKVKDISLAEWGRKAIELAENEMPGLMELRREYGPSQPLKGAKIAGCLHMTVQTAVLIETLKALGADVRWSSCNIFSTQDNAAAAIAKAGVPVFAWKGETDEEYEWCIAQTVKGFSGDGLPNMILDDGGDLTNLV 138          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_YEAST (Adenosylhomocysteinase OS=Saccharomyces cerevisiae GN=SAH1 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 8.092e-39
Identity = 88/163 (53.99%), Postives = 104/163 (63.80%), Query Frame = 2
Query:  101 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKAL-DWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPAST 586
            SA  + +K+ D+S A FGR EIELAE EMPGLMA R  +G  QP KGA+I G LHMTIQTAVLIETL ALGAEV W SCNI+STQDH              WKGET +EY WC E+ L  +      +LI+DDGGD T L+HE  K  E+ E    L +  +T
Sbjct:    2 SAPAQNYKIADISLAAFGRKEIELAEHEMPGLMAIRKAYGDVQPLKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLFAFKDNKKLNLILDDGGDLTTLVHE--KHPEMLEDCFGLSEETTT 162          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_DICDI (Adenosylhomocysteinase OS=Dictyostelium discoideum GN=sahA PE=1 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 1.057e-38
Identity = 79/136 (58.09%), Postives = 97/136 (71.32%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE 526
            +KVKD+S A +GR EIE+AE EMPGLM  R ++GP+Q  KGA+I G LHMTIQTAVLIETLTALGA+V+W SCNIFSTQD               WKGET +EY WC E+ + +  G   ++I+DDGGD T L+HE
Sbjct:    6 YKVKDISLAAWGRKEIEIAENEMPGLMTLRKKYGPAQILKGARIAGCLHMTIQTAVLIETLTALGAQVQWSSCNIFSTQDQAAAAIAATGVPVYAWKGETEEEYNWCVEQTIVFQDGQPLNMILDDGGDLTNLVHE 141          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_ROSDO (Adenosylhomocysteinase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ahcY PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.803e-38
Identity = 80/143 (55.94%), Postives = 104/143 (72.73%), Query Frame = 2
Query:  113 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            ++F VKD++ A+FGR E+++AE EMPGLMA RAE+G S+P  GA+I GSLHMTIQTAVLIETL ALGA+VRW SCNIFSTQDH               KG++L+E+W   +++  +    GP+LI+DDGGDATL +  G +AE
Sbjct:    3 KDFIVKDIALAEFGRKELDIAETEMPGLMALRAEYGDSKPLAGARIVGSLHMTIQTAVLIETLVALGADVRWASCNIFSTQDHAAAAIAAGGTPVFAIKGQSLEEHWDYLDRSFMF--EDGPNLILDDGGDATLYVLLGARAE 143          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_NITEU (Adenosylhomocysteinase OS=Nitrosomonas europaea GN=ahcY PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.803e-38
Identity = 82/142 (57.75%), Postives = 97/142 (68.31%), Query Frame = 2
Query:  122 KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGG--PDLIVDDGGDATLLIHEGVKAE 541
            KV DLS AD+GR EI +AE EMPGLMA R ++   +P  GA+I GSLHMTIQTAVLIETL ALGAEVRW SCNIFSTQDH              +KGE+L+EYW    +  +W   G    ++I+DDGGDATLL+  G KAE
Sbjct:   18 KVADLSLADWGRKEIAIAETEMPGLMALREQYADKKPLAGARIAGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAARNIPVFAYKGESLEEYWDYAHQIFEWASDGSHTANMILDDGGDATLLLILGSKAE 159          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_PROM01.631e-3955.48Adenosylhomocysteinase OS=Prochlorococcus marinus ... [more]
SAHH_CORDI1.631e-3948.35Adenosylhomocysteinase OS=Corynebacterium diphther... [more]
SAHH_DROME2.781e-3957.35Adenosylhomocysteinase OS=Drosophila melanogaster ... [more]
SAHH_BURP82.781e-3952.90Adenosylhomocysteinase OS=Burkholderia phymatum (s... [more]
SAHH_NOVAD4.744e-3958.45Adenosylhomocysteinase OS=Novosphingobium aromatic... [more]
SAHH_LEIDO4.744e-3959.56Adenosylhomocysteinase OS=Leishmania donovani PE=3... [more]
SAHH_YEAST8.092e-3953.99Adenosylhomocysteinase OS=Saccharomyces cerevisiae... [more]
SAHH_DICDI1.057e-3858.09Adenosylhomocysteinase OS=Dictyostelium discoideum... [more]
SAHH_ROSDO1.803e-3855.94Adenosylhomocysteinase OS=Roseobacter denitrifican... [more]
SAHH_NITEU1.803e-3857.75Adenosylhomocysteinase OS=Nitrosomonas europaea GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top