FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_ANOGA (Adenosylhomocysteinase OS=Anopheles gambiae GN=Ahcy13 PE=2 SV=2)

HSP 1 Score: 159.073 bits (401), Expect = 1.803e-38
Identity = 79/135 (58.52%), Postives = 94/135 (69.63%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIH 523
            +KV D+S A+FGR EI LAE EMPGLMACR ++GP +  KGA+I G LHMTIQTAVLIETL  LGAEV+W SCNIFSTQDH              WKGET +EY WC  + L +  G   ++I+DDGGD T L+H
Sbjct:    6 YKVADISLAEFGRKEIVLAENEMPGLMACRQKYGPLKILKGARIAGCLHMTIQTAVLIETLIELGAEVQWSSCNIFSTQDHAAAAMAKAGVPVYAWKGETDEEYMWCIRQTLIFPDGKPLNMILDDGGDLTNLVH 140          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BART1 (Adenosylhomocysteinase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ahcY PE=3 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 3.075e-38
Identity = 78/146 (53.42%), Postives = 99/146 (67.81%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            + ++F VKD+  A +GR E+++AE EMPGLMACR EF  SQP +GA+I+GSLHMTIQTAVLIETL A+GA++RW S NIFSTQDH               KGETL+EYW   +    W  G   ++I+DDG DAT  I  G +AE+
Sbjct:    2 TAQDFVVKDIGLAAYGRKELDIAETEMPGLMACRKEFSSSQPLRGARISGSLHMTIQTAVLIETLKAIGADIRWSSSNIFSTQDHAAAAIAATGIPVFAVKGETLEEYWTYIDAIFQWPDGHPSNMILDDGADATNYILVGSRAEQ 147          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BARHE (Adenosylhomocysteinase OS=Bartonella henselae GN=ahcY PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 4.016e-38
Identity = 79/145 (54.48%), Postives = 98/145 (67.59%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            + +++ VKD++ A +GR E+++AE EMPGLMACR EF  SQP +GA+I+GSLHMTIQTAVLIETL A+GA VRW S NIFSTQDH               KGETL+EYW   +    W  G   +LI+DDG DAT  I  G +AE
Sbjct:    2 TAQDYVVKDIALAAYGRKELDIAETEMPGLMACREEFSSSQPLRGARISGSLHMTIQTAVLIETLKAIGANVRWSSSNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYIDAIFQWPDGNPSNLILDDGADATNYILMGSRAE 146          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BURTA (Adenosylhomocysteinase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ahcY PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.851e-38
Identity = 80/155 (51.61%), Postives = 103/155 (66.45%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            M  +V  S S +++ V D++ A +GR E+ +AE EMPGL+  R E+   QP KGA+I GSLHMTIQT VLIETL ALGA+VRW SCNIFSTQDH              +KGE+L EYW  + +  +W  G   ++I+DDGGDATLL+  G KAE+
Sbjct:    1 MNAAVIDSNSAQDYVVADIALAGWGRKELNIAETEMPGLVQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGTPVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEK 155          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BURPS (Adenosylhomocysteinase OS=Burkholderia pseudomallei GN=ahcY PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.851e-38
Identity = 80/155 (51.61%), Postives = 103/155 (66.45%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            M  +V  S S +++ V D++ A +GR E+ +AE EMPGL+  R E+   QP KGA+I GSLHMTIQT VLIETL ALGA+VRW SCNIFSTQDH              +KGE+L EYW  + +  +W  G   ++I+DDGGDATLL+  G KAE+
Sbjct:    1 MNAAVIDSHSAQDYVVADIALAGWGRKELNIAETEMPGLVQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGTPVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEK 155          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BURP6 (Adenosylhomocysteinase OS=Burkholderia pseudomallei (strain 668) GN=ahcY PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.851e-38
Identity = 80/155 (51.61%), Postives = 103/155 (66.45%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            M  +V  S S +++ V D++ A +GR E+ +AE EMPGL+  R E+   QP KGA+I GSLHMTIQT VLIETL ALGA+VRW SCNIFSTQDH              +KGE+L EYW  + +  +W  G   ++I+DDGGDATLL+  G KAE+
Sbjct:    1 MNAAVIDSHSAQDYVVADIALAGWGRKELNIAETEMPGLVQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGTPVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEK 155          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BURP1 (Adenosylhomocysteinase OS=Burkholderia pseudomallei (strain 1710b) GN=ahcY PE=1 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.851e-38
Identity = 80/155 (51.61%), Postives = 103/155 (66.45%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            M  +V  S S +++ V D++ A +GR E+ +AE EMPGL+  R E+   QP KGA+I GSLHMTIQT VLIETL ALGA+VRW SCNIFSTQDH              +KGE+L EYW  + +  +W  G   ++I+DDGGDATLL+  G KAE+
Sbjct:    1 MNAAVIDSHSAQDYVVADIALAGWGRKELNIAETEMPGLVQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGTPVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEK 155          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BURP0 (Adenosylhomocysteinase OS=Burkholderia pseudomallei (strain 1106a) GN=ahcY PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.851e-38
Identity = 80/155 (51.61%), Postives = 103/155 (66.45%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            M  +V  S S +++ V D++ A +GR E+ +AE EMPGL+  R E+   QP KGA+I GSLHMTIQT VLIETL ALGA+VRW SCNIFSTQDH              +KGE+L EYW  + +  +W  G   ++I+DDGGDATLL+  G KAE+
Sbjct:    1 MNAAVIDSHSAQDYVVADIALAGWGRKELNIAETEMPGLVQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGTPVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEK 155          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BURMS (Adenosylhomocysteinase OS=Burkholderia mallei (strain SAVP1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.851e-38
Identity = 80/155 (51.61%), Postives = 103/155 (66.45%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            M  +V  S S +++ V D++ A +GR E+ +AE EMPGL+  R E+   QP KGA+I GSLHMTIQT VLIETL ALGA+VRW SCNIFSTQDH              +KGE+L EYW  + +  +W  G   ++I+DDGGDATLL+  G KAE+
Sbjct:    1 MNAAVIDSHSAQDYVVADIALAGWGRKELNIAETEMPGLVQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGTPVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEK 155          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BURMA (Adenosylhomocysteinase OS=Burkholderia mallei GN=ahcY PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.851e-38
Identity = 80/155 (51.61%), Postives = 103/155 (66.45%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            M  +V  S S +++ V D++ A +GR E+ +AE EMPGL+  R E+   QP KGA+I GSLHMTIQT VLIETL ALGA+VRW SCNIFSTQDH              +KGE+L EYW  + +  +W  G   ++I+DDGGDATLL+  G KAE+
Sbjct:    1 MNAAVIDSHSAQDYVVADIALAGWGRKELNIAETEMPGLVQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGTPVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEK 155          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_ANOGA1.803e-3858.52Adenosylhomocysteinase OS=Anopheles gambiae GN=Ahc... [more]
SAHH_BART13.075e-3853.42Adenosylhomocysteinase OS=Bartonella tribocorum (s... [more]
SAHH_BARHE4.016e-3854.48Adenosylhomocysteinase OS=Bartonella henselae GN=a... [more]
SAHH_BURTA6.851e-3851.61Adenosylhomocysteinase OS=Burkholderia thailandens... [more]
SAHH_BURPS6.851e-3851.61Adenosylhomocysteinase OS=Burkholderia pseudomalle... [more]
SAHH_BURP66.851e-3851.61Adenosylhomocysteinase OS=Burkholderia pseudomalle... [more]
SAHH_BURP16.851e-3851.61Adenosylhomocysteinase OS=Burkholderia pseudomalle... [more]
SAHH_BURP06.851e-3851.61Adenosylhomocysteinase OS=Burkholderia pseudomalle... [more]
SAHH_BURMS6.851e-3851.61Adenosylhomocysteinase OS=Burkholderia mallei (str... [more]
SAHH_BURMA6.851e-3851.61Adenosylhomocysteinase OS=Burkholderia mallei GN=a... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top