FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BURM9 (Adenosylhomocysteinase OS=Burkholderia mallei (strain NCTC 10229) GN=ahcY PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.851e-38
Identity = 80/155 (51.61%), Postives = 103/155 (66.45%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            M  +V  S S +++ V D++ A +GR E+ +AE EMPGL+  R E+   QP KGA+I GSLHMTIQT VLIETL ALGA+VRW SCNIFSTQDH              +KGE+L EYW  + +  +W  G   ++I+DDGGDATLL+  G KAE+
Sbjct:    1 MNAAVIDSHSAQDYVVADIALAGWGRKELNIAETEMPGLVQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGTPVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEK 155          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BURM7 (Adenosylhomocysteinase OS=Burkholderia mallei (strain NCTC 10247) GN=ahcY PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.851e-38
Identity = 80/155 (51.61%), Postives = 103/155 (66.45%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            M  +V  S S +++ V D++ A +GR E+ +AE EMPGL+  R E+   QP KGA+I GSLHMTIQT VLIETL ALGA+VRW SCNIFSTQDH              +KGE+L EYW  + +  +W  G   ++I+DDGGDATLL+  G KAE+
Sbjct:    1 MNAAVIDSHSAQDYVVADIALAGWGRKELNIAETEMPGLVQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLKALGADVRWASCNIFSTQDHAAAAIVEAGTPVFAFKGESLDEYWEFSHRIFEWPNGEFANMILDDGGDATLLLILGSKAEK 155          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PROMP (Adenosylhomocysteinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ahcY PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 8.947e-38
Identity = 81/142 (57.04%), Postives = 97/142 (68.31%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE 544
            + +KD+S +DFGR EI++AE EMPGLMA R +    +P  GAKI GSLHMTIQTAVLIETL  LGA+V+W SCNIFSTQDH               KGE+L EYW  T   LDWG    P++I+DDGGDAT L+  G KAE+
Sbjct:   14 YVIKDISLSDFGRKEIKIAETEMPGLMALRDKHHSDKPLNGAKIAGSLHMTIQTAVLIETLVDLGAQVKWASCNIFSTQDHAAAAIAEQGISVYAKKGESLDEYWQYTHYILDWGT-DSPNMILDDGGDATGLLILGSKAEK 154          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_HERAR (Adenosylhomocysteinase OS=Herminiimonas arsenicoxydans GN=ahcY PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 8.947e-38
Identity = 82/159 (51.57%), Postives = 105/159 (66.04%), Query Frame = 2
Query:   83 ALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW--GPGGGP---DLIVDDGGDATLLIHEGVKAEE 544
            A  +  S +  ++ + DLS + +G  EI +AE EMPGLMA R EF  +QP KGA+ITGS+HMTIQTAVLI+TL ALGA+VRW SCNI+STQDH               KGETL +YW  T +  +W     G P   ++I+DDGGDATLL+H G +AE+
Sbjct:    3 AAVMTSSTNFSDYVIADLSLSVWGDKEIRIAETEMPGLMAIREEFAAAQPLKGARITGSIHMTIQTAVLIQTLEALGAKVRWASCNIYSTQDHAAAAIAAAGTPVFAVKGETLDDYWEYTHRIFEWPNDDKGAPVYSNMILDDGGDATLLLHLGTRAEK 161          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BARQU (Adenosylhomocysteinase OS=Bartonella quintana GN=ahcY PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 8.947e-38
Identity = 79/145 (54.48%), Postives = 99/145 (68.28%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            + +++ VKD++ A +GR EI++AE EMPGLMACR EF  SQP +GA+I+GSLH+TIQTAVLIETL A+GA+VRW S NIFSTQDH               KGETL+EYW   +    W  G   +LI+DDG DAT  I  G +AE
Sbjct:    2 AAQDYVVKDIALAAYGRKEIDIAETEMPGLMACREEFSFSQPLRGARISGSLHITIQTAVLIETLKAIGADVRWSSSNIFSTQDHAAAAIAATGTAVFGVKGETLEEYWAYIDAIFQWPDGNPSNLILDDGADATNYILTGSRAE 146          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_JANMA (Adenosylhomocysteinase OS=Janthinobacterium sp. (strain Marseille) GN=ahcY PE=3 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.169e-37
Identity = 80/148 (54.05%), Postives = 101/148 (68.24%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW--GPGGGP---DLIVDDGGDATLLIHEGVKAEE 544
            ++ + DLS + +G  EI +AE EMPGLMA R EF  +QP KGA+ITGS+HMTIQTAVLI+TL ALGA+VRW SCNI+STQDH               KGETL +YW  T +  +W     G P   ++I+DDGGDATLL+H G +AE+
Sbjct:   14 DYVIADLSLSAWGDKEIRIAETEMPGLMAIREEFAAAQPLKGARITGSIHMTIQTAVLIQTLEALGAKVRWASCNIYSTQDHAAAAIAAAGTPVFAVKGETLDDYWEYTHRIFEWPNDDKGAPVYSNMILDDGGDATLLLHLGTRAEK 161          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_GRAFK (Adenosylhomocysteinase OS=Gramella forsetii (strain KT0803) GN=ahcY PE=3 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.169e-37
Identity = 88/173 (50.87%), Postives = 106/173 (61.27%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGP-DLIVDDGGDATLLI-------HEGVK---------AEEIYE--KTGKLPDPA 580
            +KVKD+  A++GR EIELAE EMPGLMA R E+G S+P KGA+I G LHMTIQTAVLIETL  LGA V W SCNIFSTQDH              WKG T +E+ WC E+ L +G    P ++I+DDGGD T ++        EG+K            +YE  K G LP PA
Sbjct:   11 YKVKDIELAEYGRREIELAEAEMPGLMALRKEYGASKPLKGARIAGCLHMTIQTAVLIETLVELGANVTWSSCNIFSTQDHAAAAIAAAGIPVYAWKGLTEEEFNWCIEQTLFFGEDRKPLNMILDDGGDLTNMVLDEYPELAEGIKGLSEETTTGVHRLYERMKKGTLPMPA 183          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHHB_XENLA (Adenosylhomocysteinase B OS=Xenopus laevis GN=ahcy-B PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.603e-37
Identity = 76/135 (56.30%), Postives = 94/135 (69.63%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIH 523
            +KV D+S AD+GR  IE+AE EMPGLM  R  +  S+P KGA+I G LHMT+QTAVLIETLTA+GAEV+W SCNIFSTQDH              WKGET +EY WC E+ + +  G   ++I+DDGGD T L+H
Sbjct:    7 YKVADISLADWGRKAIEIAENEMPGLMKMREMYSESKPLKGARIAGCLHMTLQTAVLIETLTAIGAEVQWSSCNIFSTQDHAAAAIAKTGVPVYAWKGETDEEYIWCIEQTIYFKDGKPLNMILDDGGDLTNLVH 141          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_NITEC (Adenosylhomocysteinase OS=Nitrosomonas eutropha (strain C91) GN=ahcY PE=3 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 3.400e-37
Identity = 80/142 (56.34%), Postives = 97/142 (68.31%), Query Frame = 2
Query:  122 KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGG--GPDLIVDDGGDATLLIHEGVKAE 541
            +V DLS AD+GR EI +AE EMPGLMA R ++   +P  GA+I GSLHMTIQTAVLIETL ALGAEVRW SCNIFSTQDH              +KGE+L+EYW    +  +W   G    ++I+DDGGDATLL+  G +AE
Sbjct:   18 EVADLSLADWGRKEIAIAETEMPGLMALREQYAGKKPLAGARIAGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAARDIPVFAYKGESLKEYWDYAHQIFEWTSDGSHAANMILDDGGDATLLLILGSRAE 159          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHHA_XENLA (Adenosylhomocysteinase A OS=Xenopus laevis GN=ahcy-A PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 4.440e-37
Identity = 77/135 (57.04%), Postives = 93/135 (68.89%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIH 523
            +KV D+S AD+GR  IE+AE EMPGLM  R     S+P KGA+I G LHMT+QTAVLIETLTALGAEV+W SCNIFSTQDH              WKGET +EY WC E+ + +  G   ++I+DDGGD T L+H
Sbjct:    7 YKVADISLADWGRKAIEIAENEMPGLMKMREMHSESKPLKGARIAGCLHMTLQTAVLIETLTALGAEVQWSSCNIFSTQDHAAAAIAKTGVPVYAWKGETDEEYIWCIEQTIYFKDGKPLNMILDDGGDLTNLVH 141          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_BURM96.851e-3851.61Adenosylhomocysteinase OS=Burkholderia mallei (str... [more]
SAHH_BURM76.851e-3851.61Adenosylhomocysteinase OS=Burkholderia mallei (str... [more]
SAHH_PROMP8.947e-3857.04Adenosylhomocysteinase OS=Prochlorococcus marinus ... [more]
SAHH_HERAR8.947e-3851.57Adenosylhomocysteinase OS=Herminiimonas arsenicoxy... [more]
SAHH_BARQU8.947e-3854.48Adenosylhomocysteinase OS=Bartonella quintana GN=a... [more]
SAHH_JANMA1.169e-3754.05Adenosylhomocysteinase OS=Janthinobacterium sp. (s... [more]
SAHH_GRAFK1.169e-3750.87Adenosylhomocysteinase OS=Gramella forsetii (strai... [more]
SAHHB_XENLA2.603e-3756.30Adenosylhomocysteinase B OS=Xenopus laevis GN=ahcy... [more]
SAHH_NITEC3.400e-3756.34Adenosylhomocysteinase OS=Nitrosomonas eutropha (s... [more]
SAHHA_XENLA4.440e-3757.04Adenosylhomocysteinase A OS=Xenopus laevis GN=ahcy... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top