FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_DESDG (Adenosylhomocysteinase OS=Desulfovibrio desulfuricans (strain G20) GN=ahcY PE=3 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 5.974e-50
Identity = 105/178 (58.99%), Postives = 123/178 (69.10%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE---IYEKTGKLPDPASTDYAEFQIVLTIIRDGLK 637
            E KVKDLSQADFG  E++L+E EMPGLM   A+ G  +P KG K+TGSLHMTIQTA+LI+TL  LGA++RW SCNIFSTQDH               WKGETL+EYWWCTE AL W  G GPDLIVDDGGDAT+LIH+GV+AE+   + EK        S D  EFQIV+  I   +K
Sbjct:   15 ENKVKDLSQADFGYKEMQLSEREMPGLMELIAKHGAEKPLKGLKVTGSLHMTIQTAMLIKTLYELGADIRWASCNIFSTQDHAAAAIADSGMAKVFAWKGETLEEYWWCTEMALTWPDGSGPDLIVDDGGDATMLIHKGVEAEKNPALLEK--------SYDNKEFQIVMNRIALSMK 184          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BACFR (Adenosylhomocysteinase OS=Bacteroides fragilis GN=ahcY PE=3 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 8.626e-49
Identity = 92/141 (65.25%), Postives = 109/141 (77.30%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +KV D++ ADFGR EI+LAE EMPGLMA R ++G S+P KGA+I GSLHMTIQTAVLIETL ALGAEVRWCSCNI+STQDH              WKGETL +YWWCT +AL++  G GP +IVDDGGDAT++IH G +AE
Sbjct:   26 YKVADITLADFGRKEIDLAEKEMPGLMALREKYGESKPLKGARIMGSLHMTIQTAVLIETLVALGAEVRWCSCNIYSTQDHAAAAIAASGVAVFAWKGETLADYWWCTLQALNFEGGKGPTVIVDDGGDATMMIHVGYEAE 166          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PLACH (Adenosylhomocysteinase OS=Plasmodium chabaudi GN=PC000295.02.0 PE=3 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.922e-48
Identity = 92/173 (53.18%), Postives = 122/173 (70.52%), Query Frame = 2
Query:  122 KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGG-GPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGL 634
            K+KDLS A FG+L++E++E EMPGLM  R E+   +P KGAKITG LHMTI+TA+L+ETL  LGA++RWCSCNI+ST D+               W+GETL+EYWWC EKAL WG  G GPDLIVDDG DA+ L+H+G + E++YE+   LPDP +    E +  L++I+  +
Sbjct:    7 KIKDLSLAPFGKLQMEISETEMPGLMTIREEYEKLKPLKGAKITGCLHMTIETALLMETLQKLGAKLRWCSCNIYSTLDYAAAAVSTLENVSVFAWRGETLEEYWWCVEKALTWGENGEGPDLIVDDGADASYLVHKGAEYEKLYEEKKILPDPETGKNEEERCFLSLIKSSI 179          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BACTN (Adenosylhomocysteinase OS=Bacteroides thetaiotaomicron GN=ahcY PE=3 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 3.278e-48
Identity = 91/141 (64.54%), Postives = 108/141 (76.60%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +KV D++ ADFGR EI+LAE EMPGLMA R ++G S+P KGA+I GSLHMTIQTAVLIETL ALGAEVRWCSCNI+STQDH              WKGE L +YWWCT +AL++  G GP++IVDDGGDAT++IH G  AE
Sbjct:   15 YKVADITLADFGRKEIDLAEKEMPGLMALREKYGESKPLKGARIMGSLHMTIQTAVLIETLVALGAEVRWCSCNIYSTQDHAAAAIAASGVAVFAWKGENLADYWWCTLQALNFPGGKGPNVIVDDGGDATMMIHVGYDAE 155          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_CHLL2 (Adenosylhomocysteinase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=ahcY PE=3 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.246e-47
Identity = 94/159 (59.12%), Postives = 112/159 (70.44%), Query Frame = 2
Query:  104 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPA 580
            A+   +KV D++ A++GR EIE+AE EMPGLMA R ++   +P KGA+ITGSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH              WKGE+L EYWWCT + L++  G GP+LIVDDGGDATL+IH G K E   E   K+P  A
Sbjct:    5 ATALAYKVADITLAEWGRKEIEIAEKEMPGLMATRRKYAGQKPLKGARITGSLHMTIQTAVLIETLVDLGAEVRWASCNIFSTQDHAAAAIAAAGIPVFAWKGESLDEYWWCTRQILEFEDGKGPNLIVDDGGDATLMIHLGYKIENNPELLEKVPGNA 163          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MYCUA (Adenosylhomocysteinase OS=Mycobacterium ulcerans (strain Agy99) GN=ahcY PE=3 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 3.624e-47
Identity = 96/183 (52.46%), Postives = 122/183 (66.67%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGP-DLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIR 625
            +G +FK+ DLS ADFGR E+ +AE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGE+L+EYWWC E+ L W     P ++I+DDGGDAT+L+  G++    YEK G +P     D AE+++ L ++R
Sbjct:   14 NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPEEPKGVPVFAWKGESLEEYWWCAEQMLTWPDSDKPANMILDDGGDATMLVLRGMQ----YEKAGVVPPAEEDDSAEWKVFLGLLR 192          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MYCMM (Adenosylhomocysteinase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=ahcY PE=3 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 3.624e-47
Identity = 96/183 (52.46%), Postives = 122/183 (66.67%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGP-DLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIR 625
            +G +FK+ DLS ADFGR E+ +AE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGE+L+EYWWC E+ L W     P ++I+DDGGDAT+L+  G++    YEK G +P     D AE+++ L ++R
Sbjct:   14 NGIDFKIADLSLADFGRKELRIAEHEMPGLMSLRREYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPEEPKGVPVFAWKGESLEEYWWCAEQMLTWPDSDKPANMILDDGGDATMLVLRGMQ----YEKAGVVPPAEEDDSAEWKVFLGLLR 192          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_RHOPT (Adenosylhomocysteinase OS=Rhodopseudomonas palustris (strain TIE-1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 8.074e-47
Identity = 90/147 (61.22%), Postives = 107/147 (72.79%), Query Frame = 2
Query:  101 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +A   ++ VKD+  A+FGR EI LAE EMPGLMA R E+GP QP KGAKI GSLHMTIQTAVLIETL ALGAEVRW SCNI+STQDH               KGETL++YW  T K  DW  GG P++I+DDGGDAT+ +H+G++AE
Sbjct:    2 TAKFTDYIVKDIGLAEFGRKEISLAETEMPGLMATREEYGPKQPLKGAKIAGSLHMTIQTAVLIETLVALGAEVRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLKDYWDYTAKLFDWSDGGTPNMILDDGGDATMFVHQGLRAE 148          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_RHOPA (Adenosylhomocysteinase OS=Rhodopseudomonas palustris GN=ahcY PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 8.074e-47
Identity = 90/147 (61.22%), Postives = 107/147 (72.79%), Query Frame = 2
Query:  101 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +A   ++ VKD+  A+FGR EI LAE EMPGLMA R E+GP QP KGAKI GSLHMTIQTAVLIETL ALGAEVRW SCNI+STQDH               KGETL++YW  T K  DW  GG P++I+DDGGDAT+ +H+G++AE
Sbjct:    2 TAKFTDYIVKDIGLAEFGRKEISLAETEMPGLMATREEYGPKQPLKGAKIAGSLHMTIQTAVLIETLVALGAEVRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLKDYWDYTAKLFDWSDGGTPNMILDDGGDATMFVHQGLRAE 148          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MYCLE (Adenosylhomocysteinase OS=Mycobacterium leprae GN=ahcY PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 8.074e-47
Identity = 98/183 (53.55%), Postives = 122/183 (66.67%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIR 625
            +G +FKV DLS A+FGR E++LAE EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W  P    ++I+DDGGDAT+L+  GV+    YEK G +P     D AE+++ L ++R
Sbjct:   14 NGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMILDDGGDATMLVLRGVQ----YEKAGVVPPAEVDDSAEWKVFLNLLR 192          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_DESDG5.974e-5058.99Adenosylhomocysteinase OS=Desulfovibrio desulfuric... [more]
SAHH_BACFR8.626e-4965.25Adenosylhomocysteinase OS=Bacteroides fragilis GN=... [more]
SAHH_PLACH1.922e-4853.18Adenosylhomocysteinase OS=Plasmodium chabaudi GN=P... [more]
SAHH_BACTN3.278e-4864.54Adenosylhomocysteinase OS=Bacteroides thetaiotaomi... [more]
SAHH_CHLL21.246e-4759.12Adenosylhomocysteinase OS=Chlorobium limicola (str... [more]
SAHH_MYCUA3.624e-4752.46Adenosylhomocysteinase OS=Mycobacterium ulcerans (... [more]
SAHH_MYCMM3.624e-4752.46Adenosylhomocysteinase OS=Mycobacterium marinum (s... [more]
SAHH_RHOPT8.074e-4761.22Adenosylhomocysteinase OS=Rhodopseudomonas palustr... [more]
SAHH_RHOPA8.074e-4761.22Adenosylhomocysteinase OS=Rhodopseudomonas palustr... [more]
SAHH_MYCLE8.074e-4753.55Adenosylhomocysteinase OS=Mycobacterium leprae GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top