FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PSEPW (Adenosylhomocysteinase OS=Pseudomonas putida (strain W619) GN=ahcY PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.694e-34
Identity = 78/147 (53.06%), Postives = 93/147 (63.27%), Query Frame = 2
Query:   89 SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKA-LDWGPGGGPDLIVDDGGDATLLIHE 526
            +V   A   +FKV D+S A +GR E  +AE EMP LM  R ++   QP KGAKI G +HMTIQTAVLIETL ALGAEVRW SCNIFSTQD               WKGET +EY WC E+  L  G     ++I+DDGGD T L+H+
Sbjct:    3 AVNTPAGFTDFKVADISLAAWGRRETIIAESEMPALMGLRRKYLAEQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAASIAAAGIPVFAWKGETEEEYEWCLEQTILKDGQPWDANMILDDGGDLTELLHK 149          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PSESM (Adenosylhomocysteinase OS=Pseudomonas syringae pv. tomato GN=ahcY PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 3.518e-34
Identity = 76/142 (53.52%), Postives = 91/142 (64.08%), Query Frame = 2
Query:  104 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKA-LDWGPGGGPDLIVDDGGDATLLIHE 526
            A   ++KV D+S A +GR E  +AE EMP LM  R ++   QP KGAKI G +HMTIQTAVLIETL ALGAEVRW SCNIFSTQD               WKGET +EY WC E+  L  G     ++I+DDGGD T +IH+
Sbjct:    8 AEFNDYKVADISLAAWGRRETIIAESEMPALMGLRRKYAAEQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAAAIAAAGIAVYAWKGETEEEYEWCIEQTILKDGQPWDANMILDDGGDLTEIIHK 149          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PSEPF (Adenosylhomocysteinase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 3.518e-34
Identity = 76/142 (53.52%), Postives = 91/142 (64.08%), Query Frame = 2
Query:  104 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKA-LDWGPGGGPDLIVDDGGDATLLIHE 526
            A   ++KV D+S A +GR E  +AE EMP LM  R ++   QP KGAKI G +HMTIQTAVLIETL ALGAEVRW SCNIFSTQD               WKGET +EY WC E+  L  G     ++I+DDGGD T L+H+
Sbjct:    8 ADFNDYKVADISLAAWGRRETIIAESEMPALMGLRRKYASEQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAASIAAAGIPVFAWKGETEEEYEWCLEQTILKDGQPWDANMILDDGGDLTELLHK 149          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PSEF5 (Adenosylhomocysteinase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ahcY PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 3.518e-34
Identity = 77/147 (52.38%), Postives = 93/147 (63.27%), Query Frame = 2
Query:   89 SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKA-LDWGPGGGPDLIVDDGGDATLLIHE 526
            +V   A   ++KV D+S A +GR E  +AE EMP LM  R ++   QP KGAKI G +HMTIQTAVLIETL ALGAEVRW SCNIFSTQD               WKGET +EY WC E+  L  G     ++I+DDGGD T L+H+
Sbjct:    3 AVNTPAGFTDYKVADISLAAWGRRETIIAESEMPALMGLRRKYLAEQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAASIAAAGIPVFAWKGETEEEYEWCLEQTILKDGKPWDANMILDDGGDLTQLLHD 149          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_HUMAN (Adenosylhomocysteinase OS=Homo sapiens GN=AHCY PE=1 SV=4)

HSP 1 Score: 144.436 bits (363), Expect = 4.595e-34
Identity = 72/135 (53.33%), Postives = 90/135 (66.67%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIH 523
            +KV D+  A +GR  +++AE EMPGLM  R  +  S+P KGA+I G LHMT++TAVLIETL  LGAEV+W SCNIFSTQDH              WKGET +EY WC E+ L +   G  ++I+DDGGD T LIH
Sbjct:    7 YKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTL-YFKDGPLNMILDDGGDLTNLIH 140          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PSEPG (Adenosylhomocysteinase OS=Pseudomonas putida (strain GB-1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.337e-33
Identity = 75/138 (54.35%), Postives = 90/138 (65.22%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKA-LDWGPGGGPDLIVDDGGDATLLIHE 526
            ++KV D+S A +GR E  +AE EMP LM  R ++   QP KGAKI G +HMTIQTAVLIETL ALGAEVRW SCNIFSTQD               WKGET +EY WC E+  L  G     ++I+DDGGD T L+H+
Sbjct:   12 DYKVADISLAAWGRRETIIAESEMPALMGLRRKYLTEQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAASIAAAGIPVFAWKGETEEEYEWCLEQTILKDGQPWDANMILDDGGDLTELLHK 149          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PSEP1 (Adenosylhomocysteinase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ahcY PE=3 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.337e-33
Identity = 75/138 (54.35%), Postives = 90/138 (65.22%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKA-LDWGPGGGPDLIVDDGGDATLLIHE 526
            ++KV D+S A +GR E  +AE EMP LM  R ++   QP KGAKI G +HMTIQTAVLIETL ALGAEVRW SCNIFSTQD               WKGET +EY WC E+  L  G     ++I+DDGGD T L+H+
Sbjct:   12 DYKVADISLAAWGRRETIIAESEMPALMGLRRKYLAEQPLKGAKILGCIHMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAASIAAAGIPVFAWKGETEEEYEWCLEQTILKDGQPWDANMILDDGGDLTELLHK 149          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PSEAE (Adenosylhomocysteinase OS=Pseudomonas aeruginosa GN=ahcY PE=3 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.337e-33
Identity = 76/167 (45.51%), Postives = 102/167 (61.08%), Query Frame = 2
Query:   89 SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKA-LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPAST 586
            +V   A   ++KV D++ A +GR E+ +AE EMP LM  R ++   QP KGAKI G +HMTIQT VLIETL ALGAEVRW SCNIFSTQD               WKGET +EY WC E+  L  G     ++++DDGGD T ++H+  K  ++ E+   + +  +T
Sbjct:    3 AVMTPAGFTDYKVADITLAAWGRRELIIAESEMPALMGLRRKYAGQQPLKGAKILGCIHMTIQTGVLIETLVALGAEVRWSSCNIFSTQDQAAAAIAAAGIPVFAWKGETEEEYEWCIEQTILKDGQPWDANMVLDDGGDLTEILHK--KYPQMLERIHGITEETTT 167          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PSEAB (Adenosylhomocysteinase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ahcY PE=3 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.337e-33
Identity = 76/167 (45.51%), Postives = 102/167 (61.08%), Query Frame = 2
Query:   89 SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKA-LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPAST 586
            +V   A   ++KV D++ A +GR E+ +AE EMP LM  R ++   QP KGAKI G +HMTIQT VLIETL ALGAEVRW SCNIFSTQD               WKGET +EY WC E+  L  G     ++++DDGGD T ++H+  K  ++ E+   + +  +T
Sbjct:    3 AVMTPAGFTDYKVADITLAAWGRRELIIAESEMPALMGLRRKYAGQQPLKGAKILGCIHMTIQTGVLIETLVALGAEVRWSSCNIFSTQDQAAAAIAAAGIPVFAWKGETEEEYEWCIEQTILKDGQPWDANMVLDDGGDLTEILHK--KYPQMLERIHGITEETTT 167          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PSEA8 (Adenosylhomocysteinase OS=Pseudomonas aeruginosa (strain LESB58) GN=ahcY PE=3 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.337e-33
Identity = 76/167 (45.51%), Postives = 102/167 (61.08%), Query Frame = 2
Query:   89 SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKA-LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPAST 586
            +V   A   ++KV D++ A +GR E+ +AE EMP LM  R ++   QP KGAKI G +HMTIQT VLIETL ALGAEVRW SCNIFSTQD               WKGET +EY WC E+  L  G     ++++DDGGD T ++H+  K  ++ E+   + +  +T
Sbjct:    3 AVMTPAGFTDYKVADITLAAWGRRELIIAESEMPALMGLRRKYAGQQPLKGAKILGCIHMTIQTGVLIETLVALGAEVRWSSCNIFSTQDQAAAAIAAAGIPVFAWKGETEEEYEWCIEQTILKDGQPWDANMVLDDGGDLTEILHK--KYPQMLERIHGITEETTT 167          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_PSEPW2.694e-3453.06Adenosylhomocysteinase OS=Pseudomonas putida (stra... [more]
SAHH_PSESM3.518e-3453.52Adenosylhomocysteinase OS=Pseudomonas syringae pv.... [more]
SAHH_PSEPF3.518e-3453.52Adenosylhomocysteinase OS=Pseudomonas fluorescens ... [more]
SAHH_PSEF53.518e-3452.38Adenosylhomocysteinase OS=Pseudomonas fluorescens ... [more]
SAHH_HUMAN4.595e-3453.33Adenosylhomocysteinase OS=Homo sapiens GN=AHCY PE=... [more]
SAHH_PSEPG1.337e-3354.35Adenosylhomocysteinase OS=Pseudomonas putida (stra... [more]
SAHH_PSEP11.337e-3354.35Adenosylhomocysteinase OS=Pseudomonas putida (stra... [more]
SAHH_PSEAE1.337e-3345.51Adenosylhomocysteinase OS=Pseudomonas aeruginosa G... [more]
SAHH_PSEAB1.337e-3345.51Adenosylhomocysteinase OS=Pseudomonas aeruginosa (... [more]
SAHH_PSEA81.337e-3345.51Adenosylhomocysteinase OS=Pseudomonas aeruginosa (... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top