FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH2_DROME (Putative adenosylhomocysteinase 2 OS=Drosophila melanogaster GN=Ahcy89E PE=1 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 5.081e-33
Identity = 69/142 (48.59%), Postives = 92/142 (64.79%), Query Frame = 2
Query:   95 QKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLI 520
            + SA G +F VK +S++ FGR EIE+AE EMPG+M  R      +P KGA I G  H+  Q+AVLIETL  LGA VRW +CNI+STQ+               W+GET +E+WWC ++A+ +  G  P+LI+DDGGDAT L+
Sbjct:   60 RNSAGGTDFCVKSISKSAFGRREIEIAESEMPGIMTLRKRAKDEKPLKGANIVGCTHVNAQSAVLIETLVQLGATVRWAACNIYSTQNAVAAALAEAGIPIFAWRGETEEEFWWCLDRAI-YSDGWQPNLILDDGGDATHLM 200          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH3_PONAB (Putative adenosylhomocysteinase 3 OS=Pongo abelii GN=AHCYL2 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.360e-30
Identity = 67/145 (46.21%), Postives = 93/145 (64.14%), Query Frame = 2
Query:   95 QKSASGR-EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE 526
            QK++ G  +F VK++ QA+FGR EIE+AE EMP LMA R      +P  GAKI G  H+T QTAVL+ETL ALGA+ RW +CNI+ST +               WKGE+  ++WWC ++ ++   G  P++I+DDGGD T  I++
Sbjct:   74 QKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVN-VEGWQPNMILDDGGDLTHWIYK 217          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH3_MOUSE (Putative adenosylhomocysteinase 3 OS=Mus musculus GN=Ahcyl2 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.360e-30
Identity = 67/145 (46.21%), Postives = 93/145 (64.14%), Query Frame = 2
Query:   95 QKSASGR-EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE 526
            QK++ G  +F VK++ QA+FGR EIE+AE EMP LMA R      +P  GAKI G  H+T QTAVL+ETL ALGA+ RW +CNI+ST +               WKGE+  ++WWC ++ ++   G  P++I+DDGGD T  I++
Sbjct:  179 QKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVN-VEGWQPNMILDDGGDLTHWIYK 322          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH3_HUMAN (Putative adenosylhomocysteinase 3 OS=Homo sapiens GN=AHCYL2 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.360e-30
Identity = 67/145 (46.21%), Postives = 93/145 (64.14%), Query Frame = 2
Query:   95 QKSASGR-EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE 526
            QK++ G  +F VK++ QA+FGR EIE+AE EMP LMA R      +P  GAKI G  H+T QTAVL+ETL ALGA+ RW +CNI+ST +               WKGE+  ++WWC ++ ++   G  P++I+DDGGD T  I++
Sbjct:  177 QKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVN-VEGWQPNMILDDGGDLTHWIYK 320          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PNECA (Adenosylhomocysteinase (Fragment) OS=Pneumocystis carinii GN=SAHH PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.609e-29
Identity = 70/128 (54.69%), Postives = 83/128 (64.84%), Query Frame = 2
Query:  143 ADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKAL-DWGPGGGPDLIVDDGGDATLLIH 523
            A++GR EIELAE EMPGL++CR      +P +  +I G LHMTIQTAVLIETL  LGAEV W SCNIFSTQDH              WKGET +EY WC E  L  +  G   ++I+DDGGD T L+H
Sbjct:    7 AEWGRKEIELAENEMPGLISCRRNMR-FKPLR-VQIAGCLHMTIQTAVLIETLVELGAEVTWSSCNIFSTQDHAAAAIAASGISVFAWKGETEEEYLWCIETQLTSFKDGKHLNMILDDGGDVTSLVH 132          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH2_MOUSE (Putative adenosylhomocysteinase 2 OS=Mus musculus GN=Ahcyl1 PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 3.768e-28
Identity = 63/152 (41.45%), Postives = 92/152 (60.53%), Query Frame = 2
Query:  101 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEK 556
            S     F VK++ QA+FGR EIE+AE +M  L++ R      +P  GAKI G  H+T QTAVLIETL ALGA+ RW +CNI+STQ+               WKGE+  ++WWC ++ ++   G   ++I+DDGGD T  +++  K   +++K
Sbjct:   99 SKGSSNFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVNM-DGWQANMILDDGGDLTHWVYK--KYPNVFKK 247          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH2_HUMAN (Putative adenosylhomocysteinase 2 OS=Homo sapiens GN=AHCYL1 PE=1 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 3.768e-28
Identity = 63/152 (41.45%), Postives = 92/152 (60.53%), Query Frame = 2
Query:  101 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEK 556
            S     F VK++ QA+FGR EIE+AE +M  L++ R      +P  GAKI G  H+T QTAVLIETL ALGA+ RW +CNI+STQ+               WKGE+  ++WWC ++ ++   G   ++I+DDGGD T  +++  K   +++K
Sbjct:   99 SKGSSNFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVNM-DGWQANMILDDGGDLTHWVYK--KYPNVFKK 247          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_AERPE (Adenosylhomocysteinase OS=Aeropyrum pernix GN=ahcY PE=3 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 1.387e-22
Identity = 58/140 (41.43%), Postives = 78/140 (55.71%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKA 538
            FKV+DLS A  GR++IE AE  MP LM  R+  G  +P  G ++   LH+T +TAVL+ETL   GAEV     N  STQD               W+G T +EY W    AL    G  PD+++DDG D  +L+HE +++
Sbjct:    5 FKVRDLSLAGEGRMQIEWAERHMPVLMRLRSSMGGDKPLSGVRVAACLHVTKETAVLVETLRKWGAEVYLAPSNPLSTQDEVAAALAEAGIGVFAWRGMTPEEYKW----ALSTVAGREPDIVIDDGADLHVLLHEEMRS 140          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_SULAC (Adenosylhomocysteinase OS=Sulfolobus acidocaldarius GN=ahcY PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.892e-20
Identity = 55/137 (40.15%), Postives = 76/137 (55.47%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE 526
            +++VKDLS A+ GR +IE AE+ MP LM  R  F   +P  G +I   LH+T +TAVL+ETL A GAE+     N  STQD               W+GET ++Y+    + L +     P +I+DDGGD    +HE
Sbjct:    2 DYRVKDLSLAEQGRKQIEWAELHMPALMEIRKRFNAEKPLDGIRIGAVLHVTKETAVLVETLKAGGAEIALAGSNPLSTQDDVAAGLAKNGIHVYAWRGETEKDYYDNIREILKY----EPHVIMDDGGDLHAYVHE 134          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_SULTO (Adenosylhomocysteinase OS=Sulfolobus tokodaii GN=ahcY PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.777e-20
Identity = 54/148 (36.49%), Postives = 83/148 (56.08%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKT 559
            ++KVKDLS A+ G+ +IE AE+ MP LM  R +F   +P +G +I+  LH+T +TAVL++TL   GA V     N  STQD               W+GET ++Y+   ++ L +     P +I+DDGGD    +HE +   +++  T
Sbjct:    2 DYKVKDLSLAEQGKKQIEWAEIHMPALMEIRKQFEKEKPLQGLRISAVLHVTKETAVLVKTLKIGGATVALAGSNPLSTQDDVAAALVEEGIRVFAWRGETEKDYYDNIKEILKY----EPQIIMDDGGDLHAYVHENMPQLKLFGGT 145          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH2_DROME5.081e-3348.59Putative adenosylhomocysteinase 2 OS=Drosophila me... [more]
SAHH3_PONAB2.360e-3046.21Putative adenosylhomocysteinase 3 OS=Pongo abelii ... [more]
SAHH3_MOUSE2.360e-3046.21Putative adenosylhomocysteinase 3 OS=Mus musculus ... [more]
SAHH3_HUMAN2.360e-3046.21Putative adenosylhomocysteinase 3 OS=Homo sapiens ... [more]
SAHH_PNECA2.609e-2954.69Adenosylhomocysteinase (Fragment) OS=Pneumocystis ... [more]
SAHH2_MOUSE3.768e-2841.45Putative adenosylhomocysteinase 2 OS=Mus musculus ... [more]
SAHH2_HUMAN3.768e-2841.45Putative adenosylhomocysteinase 2 OS=Homo sapiens ... [more]
SAHH_AERPE1.387e-2241.43Adenosylhomocysteinase OS=Aeropyrum pernix GN=ahcY... [more]
SAHH_SULAC2.892e-2040.15Adenosylhomocysteinase OS=Sulfolobus acidocaldariu... [more]
SAHH_SULTO3.777e-2036.49Adenosylhomocysteinase OS=Sulfolobus tokodaii GN=a... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top