FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_DESVH (Adenosylhomocysteinase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=ahcY PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.349e-46
Identity = 95/182 (52.20%), Postives = 119/182 (65.38%), Query Frame = 2
Query:   83 ALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPA----STDYAEFQIVL 613
            A   QK     + KV D+S AD+GR +++L+E EMPGLM    ++G ++P KG K+TGSLHMTIQTA+LI TL  LGA++RW SCNIFSTQDH               WKGETL++YWWCTE AL W  G GPDL+VDDGGDATL IH+GV+ E          DP+    + D  EFQI++
Sbjct:    4 AKRAQKLDLSLDHKVADMSLADYGRKDLQLSEREMPGLMELIRKYGGTKPLKGLKVTGSLHMTIQTAMLIRTLYELGADIRWASCNIFSTQDHAAAAIAASGMAKVFAWKGETLEDYWWCTEMALTWPDGSGPDLLVDDGGDATLFIHKGVEVEN---------DPSLLKKAYDNKEFQIIM 176          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PELLD (Adenosylhomocysteinase OS=Pelodictyon luteolum (strain DSM 273) GN=ahcY PE=3 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.007e-46
Identity = 88/146 (60.27%), Postives = 107/146 (73.29%), Query Frame = 2
Query:  104 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            A+   +KV D+S A++GR EI++AE EMPGLMA R ++   +P KGA++ GSLHMTIQTAVLIETL  LGA+VRW SCNIFSTQDH              WKGETL++YWWCT + LD+G G GP+LIVDDGGDATL+I  G K E
Sbjct:    5 ATALAYKVADISLAEWGRKEIDIAEKEMPGLMAIRKKYAGQKPLKGARVAGSLHMTIQTAVLIETLVDLGADVRWASCNIFSTQDHAAAAIAATGVPVFAWKGETLEDYWWCTRQILDFGDGQGPNLIVDDGGDATLMIILGYKIE 150          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_NOCFA (Adenosylhomocysteinase OS=Nocardia farcinica GN=ahcY PE=3 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.007e-46
Identity = 95/183 (51.91%), Postives = 122/183 (66.67%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRD 628
            +G ++KV DL+ A+FGR EI LAE EMPGLMA R E+   QP KGA+I+GSLHMT+QTAVLIETLTALGA+VRW SCNIFSTQDH                       WKGETL+EYWW  E+ L W PG   ++I+DDGGDAT+L+  G +    +EK G +P   +   AE+++ L ++R+
Sbjct:   18 NGIDYKVADLTLAEFGRKEIRLAEHEMPGLMALRREYADVQPLKGARISGSLHMTVQTAVLIETLTALGAQVRWASCNIFSTQDHAAAAVVVGPHGTVEEPKGVSVFAWKGETLEEYWWAAEQMLTW-PGEPANMILDDGGDATMLVLRGAQ----FEKAGVVPPEDADHSAEYKVFLNLLRE 195          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MYCPA (Adenosylhomocysteinase OS=Mycobacterium paratuberculosis GN=ahcY PE=3 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.007e-46
Identity = 98/187 (52.41%), Postives = 120/187 (64.17%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-----GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIR 625
            +G EFKV DLS AD+GR +IEL+E EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETL ALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+AL W     G     ++I+DDGGDAT+L+  G +    YEK G +P     D AE ++ L ++R
Sbjct:   14 NGIEFKVADLSLADYGRRDIELSEQEMPGLMSLRREYHDVQPLKGARISGSLHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPEEPRGVPVFAWKGETLEEYWWAAEQALTWPPLADGTEAPANMILDDGGDATMLVLRGAQ----YEKAGVVPPDDEDDSAEHRVFLNLLR 196          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PELPB (Adenosylhomocysteinase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.233e-46
Identity = 92/152 (60.53%), Postives = 107/152 (70.39%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLP 571
            ++KV DLS A++GR EI++AE EMPGLMA R ++    P KGA+I GSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH              WKGETL+EYWWCT + L++  G GP+LIVDDGGDATL+I  G K E   E   K P
Sbjct:    9 DYKVADLSLAEWGRKEIDVAEKEMPGLMATRRKYAGQYPLKGARIAGSLHMTIQTAVLIETLVELGAEVRWASCNIFSTQDHAAAAIAKSGVPVFAWKGETLEEYWWCTRQILEFEGGKGPNLIVDDGGDATLMIILGYKIENNPELLEKAP 160          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_CHLTE (Adenosylhomocysteinase OS=Chlorobium tepidum GN=ahcY PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 8.926e-46
Identity = 91/155 (58.71%), Postives = 107/155 (69.03%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPA 580
            ++KV D+S A++GR EIE+AE EMPGLMA R ++   +P  GA+I GSLHMTIQTAVLIETL  LGA+VRW SCNIFSTQDH              WKGETL EYWWCT + L++  G GP+LIVDDGGDATL+IH G K E       K P  A
Sbjct:    9 DYKVADISLAEWGRKEIEIAEKEMPGLMATRKKYEGKKPLAGARIAGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAIAAAGVPVFAWKGETLDEYWWCTRQILEFEGGLGPNLIVDDGGDATLMIHFGYKIENDPSMLDKTPGNA 163          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_CHLPD (Adenosylhomocysteinase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=ahcY PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 8.926e-46
Identity = 88/141 (62.41%), Postives = 103/141 (73.05%), Query Frame = 2
Query:  119 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +KV D+S A++GR EI++AE EMPGLMA R ++   +P KGA+I GSLHMTIQTAVLIETL  LGA+VRW SCNIFSTQDH              WKGETL EYWWCT + L++  G GP LIVDDGGDATL+IH G K E
Sbjct:   10 YKVADMSLAEWGRKEIDIAEKEMPGLMATRKKYAGQKPLKGARIAGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAIAKAGIPVFAWKGETLDEYWWCTRQILEFEGGKGPHLIVDDGGDATLMIHLGYKIE 150          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_CHLP8 (Adenosylhomocysteinase OS=Chlorobaculum parvum (strain NCIB 8327) GN=ahcY PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 8.926e-46
Identity = 91/155 (58.71%), Postives = 107/155 (69.03%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPA 580
            ++KV D+S A++GR EIE+AE EMPGLMA R ++   +P  GA+I GSLHMTIQTAVLIETL  LGA+VRW SCNIFSTQDH              WKGETL EYWWCT + L++  G GP+LIVDDGGDATL+IH G K E       K P  A
Sbjct:    9 DYKVADISLAEWGRKEIEIAEKEMPGLMATRKKYEGKKPLAGARIAGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAIAAAGVPVFAWKGETLDEYWWCTRQILEFEGGLGPNLIVDDGGDATLMIHLGYKIENDPSMLDKTPGNA 163          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BRASB (Adenosylhomocysteinase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ahcY PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 8.926e-46
Identity = 94/166 (56.63%), Postives = 113/166 (68.07%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVL 613
            ++ VKD+S A+FGR EI LAE EMPGLMA R E+GP QP KGA+I GSLHMTIQTAVLIETL ALGA++RW SCNI+STQDH               KGETL +YW  T K  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  PAS +   F  +L
Sbjct:    9 DYIVKDISLAEFGRKEISLAETEMPGLMATREEYGPKQPLKGARIAGSLHMTIQTAVLIETLAALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLADYWDYTAKLFDWHGGGHPNMILDDGGDATMYVHLGLRAEN--GDTAFLDKPASEEEEVFFALL 172          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_BRAJA (Adenosylhomocysteinase OS=Bradyrhizobium japonicum GN=ahcY PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 8.926e-46
Identity = 94/166 (56.63%), Postives = 111/166 (66.87%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVL 613
            ++ VKD+S ADFGR E+ LAE EMPGLMA R EFGP QP KGA+I GSLHMTIQT VLIETL ALGA++RW SCNI+STQDH               KGETL EYW  T K  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  P S +   F  +L
Sbjct:    9 DYIVKDISLADFGRKELSLAETEMPGLMATREEFGPKQPLKGARIAGSLHMTIQTGVLIETLAALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLTEYWDYTAKLFDWHGGGHPNMILDDGGDATMYVHLGLRAEN--GDTAFLDKPGSEEEEVFFALL 172          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_DESVH2.349e-4652.20Adenosylhomocysteinase OS=Desulfovibrio vulgaris (... [more]
SAHH_PELLD4.007e-4660.27Adenosylhomocysteinase OS=Pelodictyon luteolum (st... [more]
SAHH_NOCFA4.007e-4651.91Adenosylhomocysteinase OS=Nocardia farcinica GN=ah... [more]
SAHH_MYCPA4.007e-4652.41Adenosylhomocysteinase OS=Mycobacterium paratuberc... [more]
SAHH_PELPB5.233e-4660.53Adenosylhomocysteinase OS=Pelodictyon phaeoclathra... [more]
SAHH_CHLTE8.926e-4658.71Adenosylhomocysteinase OS=Chlorobium tepidum GN=ah... [more]
SAHH_CHLPD8.926e-4662.41Adenosylhomocysteinase OS=Chlorobium phaeobacteroi... [more]
SAHH_CHLP88.926e-4658.71Adenosylhomocysteinase OS=Chlorobaculum parvum (st... [more]
SAHH_BRASB8.926e-4656.63Adenosylhomocysteinase OS=Bradyrhizobium sp. (stra... [more]
SAHH_BRAJA8.926e-4656.63Adenosylhomocysteinase OS=Bradyrhizobium japonicum... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top