FC876218

Overview
NameFC876218
Unique NameFC876218
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length675
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSB_PETHY (Chalcone synthase B OS=Petunia hybrida GN=CHSB PE=2 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 9.699e-78
Identity = 127/172 (73.84%), Postives = 151/172 (87.79%), Query Frame = 2
Query:   80 AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            AQRA+GPA +LAIGTATP H V+Q  YPDYYFR+T S+H+ +LKEKF+R+C K+MIKKR+M+LTEE+L++NP +C++  PSLD RQDI+V E+PKLGKEAA KAI EWGQPKS ITHL+FCT SGVDMPGAD QL KL+GL PSV+R MMYQQGCFAGGT+LRLAKDLAENN
Sbjct:   13 AQRAEGPAKILAIGTATPFHWVDQNSYPDYYFRVTNSQHLVDLKEKFRRICSKTMIKKRHMFLTEELLRKNPTLCSHNEPSLDIRQDILVSEIPKLGKEAALKAIGEWGQPKSTITHLVFCTRSGVDMPGADCQLVKLLGLSPSVQRLMMYQQGCFAGGTMLRLAKDLAENN 184          

HSP 2 Score: 38.1206 bits (87), Expect = 9.699e-78
Identity = 15/27 (55.56%), Postives = 24/27 (88.89%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVC+E +A+ FRGP++ ++D+
Sbjct:  185 KGARVLVVCAESSAIGFRGPSEANVDN 211          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: DPS1_PINST (Pinosylvin synthase 1 OS=Pinus strobus GN=STS1 PE=1 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 4.366e-75
Identity = 119/179 (66.48%), Postives = 152/179 (84.92%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYM-APSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            ++  R +QRADG A++LAIGTA P + V+Q+ YPDYYFR+T +E  T+LK+KFKR+C++S IKKR+MYLTEEILK+NP +CA++  PSLD RQ ++  EVP+LGKEAA KAI+EWGQPKS+ITHLIFCTT+  D+PGAD+++ KL+GL PSVKR  ++Q GCFAGGTVLRLAKDLAENN
Sbjct:    9 LEAFRKSQRADGFASILAIGTANPPNVVDQSTYPDYYFRVTNNEDNTDLKDKFKRICERSAIKKRHMYLTEEILKKNPELCAFLEVPSLDTRQAMLAAEVPRLGKEAAEKAIEEWGQPKSRITHLIFCTTTTPDLPGADFEVAKLLGLHPSVKRVGVFQHGCFAGGTVLRLAKDLAENN 187          

HSP 2 Score: 48.9062 bits (115), Expect = 4.366e-75
Identity = 22/26 (84.62%), Postives = 25/26 (96.15%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLD 672
            +GARVLVVCSE TAVTFRGP++THLD
Sbjct:  188 RGARVLVVCSENTAVTFRGPSETHLD 213          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: DPS2_PINST (Pinosylvin synthase 2 OS=Pinus strobus GN=STS2 PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 7.426e-75
Identity = 120/179 (67.04%), Postives = 152/179 (84.92%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYM-APSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            ++  R +QRADG A++LAIGTA P + V+Q+ YPDYYFR T +E  T+LK+KFKR+C++S IKKR+MYLTEEILK+NP +CA++  PSLD RQ ++ VEVP+LGKEAA KAI+EWGQPKS+ITHLIFCTT+  D+PGAD+++ KL+GL PSVKR  ++Q GCFAGGTVLRLAKDLAENN
Sbjct:    9 LEAFRKSQRADGFASILAIGTANPPNVVDQSTYPDYYFRNTNNEDNTDLKDKFKRICERSAIKKRHMYLTEEILKKNPELCAFLEVPSLDTRQAMLAVEVPRLGKEAAEKAIEEWGQPKSRITHLIFCTTTTPDLPGADFEVAKLLGLHPSVKRVGVFQHGCFAGGTVLRLAKDLAENN 187          

HSP 2 Score: 48.9062 bits (115), Expect = 7.426e-75
Identity = 22/26 (84.62%), Postives = 25/26 (96.15%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLD 672
            +GARVLVVCSE TAVTFRGP++THLD
Sbjct:  188 RGARVLVVCSENTAVTFRGPSETHLD 213          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: DPSS_PINSY (Dihydropinosylvin synthase OS=Pinus sylvestris PE=1 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 3.655e-74
Identity = 118/175 (67.43%), Postives = 151/175 (86.29%), Query Frame = 2
Query:   74 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYM-APSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            R  QRADG A++LAIGTA P ++V+Q+ YPD+YFRIT +EH TELK+KFKR+C++S IK+RYMYLTEEILK+NP++CA++  PSLDARQ ++ +EVP+L KEAA KAI+EWGQ KS ITHLIFC+T+  D+PGAD+++ KL+GL PSVKR  ++Q GCFAGGTVLR+AKDLAENN
Sbjct:   10 RKLQRADGFASILAIGTANPPNAVDQSTYPDFYFRITGNEHNTELKDKFKRICERSAIKQRYMYLTEEILKKNPDVCAFVEVPSLDARQAMLAMEVPRLAKEAAEKAIQEWGQSKSGITHLIFCSTTTPDLPGADFEVAKLLGLHPSVKRVGVFQHGCFAGGTVLRMAKDLAENN 184          

HSP 2 Score: 50.8322 bits (120), Expect = 3.655e-74
Identity = 22/27 (81.48%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLV+CSE TAVTFRGP++THLDS
Sbjct:  185 RGARVLVICSETTAVTFRGPSETHLDS 211          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSA_IPOPL (Chalcone synthase A (Fragment) OS=Ipomoea platensis GN=CHSA PE=2 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.644e-71
Identity = 122/174 (70.11%), Postives = 147/174 (84.48%), Query Frame = 2
Query:   74 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            R A+R +G A +LA+GTATPA+ V+Q  YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR++ LTEE+LK+NPN+C Y   SL+ RQD +V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAENN
Sbjct:   12 RRAKRFEGHAKILAVGTATPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKRHLVLTEELLKKNPNLCTYNETSLNTRQDTLVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNISVKRLMMYQQGCNAGAAMLRLAKDLAENN 185          

HSP 2 Score: 35.4242 bits (80), Expect = 1.644e-71
Identity = 15/21 (71.43%), Postives = 18/21 (85.71%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPA 657
            +GARVLVVCSE+T   FRGP+
Sbjct:  186 KGARVLVVCSEVTLSVFRGPS 206          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_PERAE (Chalcone synthase OS=Persea americana GN=CHS PE=2 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 2.794e-71
Identity = 121/182 (66.48%), Postives = 137/182 (75.27%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYY-FRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M  V+ IR  QRA+GPAT++AIGT+TP ++V+Q++YPDYY F    +      +  FKRMC+KSMIKKRYMYLTE   K            L ARQD+VVVEVPKLGKE   KAIK  GQPKSKI  L+FCTTSGVDMPGADYQLTK+ GL PSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVNVEAIRKVQRAEGPATIMAIGTSTPPNAVDQSEYPDYYYFGSPTASTRPSSRRSFKRMCEKSMIKKRYMYLTETYWKRIQMFVPTWLLPLKARQDMVVVEVPKLGKEVQPKAIKGMGQPKSKINPLVFCTTSGVDMPGADYQLTKVFGLPPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 182          

HSP 2 Score: 54.6842 bits (130), Expect = 2.794e-71
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  183 KGARVLVVCSEITAVTFRGPSDTHLDS 209          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSB_IPOPU (Chalcone synthase B OS=Ipomoea purpurea GN=CHSB PE=3 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.375e-70
Identity = 122/174 (70.11%), Postives = 147/174 (84.48%), Query Frame = 2
Query:   74 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            R A+R +G A +LAIGTATPA  V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I+KR++ LTEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAE+N
Sbjct:   14 RRAKRLEGDAKILAIGTATPASWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIRKRHLVLTEELLKKNPNLCTYNETSLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAESN 187          

HSP 2 Score: 32.3426 bits (72), Expect = 1.375e-70
Identity = 14/21 (66.67%), Postives = 17/21 (80.95%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPA 657
            +G RVLVVC+EIT   FRGP+
Sbjct:  188 KGGRVLVVCAEITINIFRGPS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSA_IPOTF (Chalcone synthase A (Fragment) OS=Ipomoea trifida GN=CHSA PE=3 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.376e-70
Identity = 125/181 (69.06%), Postives = 151/181 (83.43%), Query Frame = 2
Query:   56 ATVQEIRN-AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            ATVQ   + A+R +G A +LAIGTATP + V+QA YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR++ LT+E+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRL KDLAENN
Sbjct:    5 ATVQLTDDTAKRFEGHAKLLAIGTATPTNWVDQATYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKRHLVLTKELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLVKDLAENN 185          

HSP 2 Score: 35.039 bits (79), Expect = 1.376e-70
Identity = 16/21 (76.19%), Postives = 18/21 (85.71%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPA 657
            +GARVLVVCSEIT   FRGP+
Sbjct:  186 KGARVLVVCSEITINIFRGPS 206          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSB_IPOCO (Chalcone synthase B (Fragment) OS=Ipomoea cordatotriloba GN=CHSB PE=3 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 2.339e-70
Identity = 121/174 (69.54%), Postives = 147/174 (84.48%), Query Frame = 2
Query:   74 RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            R  +R +G A +LAIGTATPA+ V+Q  YPD+YFRIT S+H+ + KEKF+R+C+KS I+KR+M LTEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKD+AENN
Sbjct:   14 RREKRFEGHAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLDHKEKFRRICNKSKIRKRHMILTEELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDVAENN 187          

HSP 2 Score: 33.113 bits (74), Expect = 2.339e-70
Identity = 14/21 (66.67%), Postives = 17/21 (80.95%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPA 657
            +GARVLVVCSE+    FRGP+
Sbjct:  188 KGARVLVVCSEVMLSVFRGPS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSA_IPOPU (Chalcone synthase A OS=Ipomoea purpurea GN=CHSA PE=3 SV=2)

HSP 1 Score: 254.603 bits (649), Expect = 5.185e-70
Identity = 121/172 (70.35%), Postives = 146/172 (84.88%), Query Frame = 2
Query:   80 AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            A+R +G A +LAIGTATPA+ V+Q  YPD+YFRIT SEH+ E KEKF+R+C+KS I KR++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGK+AA KAIKEWG+P S+ITHL+FCTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAENN
Sbjct:   16 AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIMKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKDAAMKAIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENN 187          

HSP 2 Score: 31.5722 bits (70), Expect = 5.185e-70
Identity = 13/21 (61.90%), Postives = 16/21 (76.19%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPA 657
            +G RVLVVCSE+    FRGP+
Sbjct:  188 KGGRVLVVCSEVMLSVFRGPS 208          
The following BLAST results are available for this feature:
BLAST of FC876218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSB_PETHY9.699e-7873.84Chalcone synthase B OS=Petunia hybrida GN=CHSB PE=... [more]
DPS1_PINST4.366e-7566.48Pinosylvin synthase 1 OS=Pinus strobus GN=STS1 PE=... [more]
DPS2_PINST7.426e-7567.04Pinosylvin synthase 2 OS=Pinus strobus GN=STS2 PE=... [more]
DPSS_PINSY3.655e-7467.43Dihydropinosylvin synthase OS=Pinus sylvestris PE=... [more]
CHSA_IPOPL1.644e-7170.11Chalcone synthase A (Fragment) OS=Ipomoea platensi... [more]
CHSY_PERAE2.794e-7166.48Chalcone synthase OS=Persea americana GN=CHS PE=2 ... [more]
CHSB_IPOPU1.375e-7070.11Chalcone synthase B OS=Ipomoea purpurea GN=CHSB PE... [more]
CHSA_IPOTF1.376e-7069.06Chalcone synthase A (Fragment) OS=Ipomoea trifida ... [more]
CHSB_IPOCO2.339e-7069.54Chalcone synthase B (Fragment) OS=Ipomoea cordatot... [more]
CHSA_IPOPU5.185e-7070.35Chalcone synthase A OS=Ipomoea purpurea GN=CHSA PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H02EF DevOvary1 Citrus clementina cDNA clone C32001H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876218 ID=FC876218|Name=FC876218|organism=Citrus clementina|type=EST|length=675bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCT
back to top