FC876218

Overview
NameFC876218
Unique NameFC876218
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length675
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS4_BROFI (Chalcone synthase 4 OS=Bromheadia finlaysoniana GN=CHS4 PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 1.938e-96
Identity = 153/178 (85.96%), Postives = 169/178 (94.94%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            ++EIR AQRA+GPA VLAIGT+TP +++ QADYPDYYFRITKSEH+TELKEKFKRMCDKSMIKKRYMYLTEEILKENPN+CA+MAPSLDARQDIVV EVPKL KEAA +AIKEWG PKS+ITHLIFCTTSG+DMPGADYQLT+L+GLRPSV RFM+YQQGCFAGGTVLRLAKDLAENN
Sbjct:    5 MEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNICAFMAPSLDARQDIVVTEVPKLAKEAAVRAIKEWGHPKSRITHLIFCTTSGIDMPGADYQLTRLLGLRPSVNRFMLYQQGCFAGGTVLRLAKDLAENN 182          

HSP 2 Score: 51.2174 bits (121), Expect = 1.938e-96
Identity = 23/26 (88.46%), Postives = 26/26 (100.00%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDS 675
            GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:  184 GARVLVVCSEITAVTFRGPSESHLDS 209          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS3_BROFI (Chalcone synthase 3 OS=Bromheadia finlaysoniana GN=CHS3 PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 1.938e-96
Identity = 153/178 (85.96%), Postives = 169/178 (94.94%), Query Frame = 2
Query:   62 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            ++EIR AQRA+GPA VLAIGT+TP +++ QADYPDYYFRITKSEH+TELKEKFKRMCDKSMIKKRYMYLTEEILKENPN+CA+MAPSLDARQDIVV EVPKL KEAA +AIKEWG PKS+ITHLIFCTTSG+DMPGADYQLT+L+GLRPSV RFM+YQQGCFAGGTVLRLAKDLAENN
Sbjct:    5 MEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNICAFMAPSLDARQDIVVTEVPKLAKEAAVRAIKEWGHPKSRITHLIFCTTSGIDMPGADYQLTRLLGLRPSVNRFMLYQQGCFAGGTVLRLAKDLAENN 182          

HSP 2 Score: 51.2174 bits (121), Expect = 1.938e-96
Identity = 23/26 (88.46%), Postives = 26/26 (100.00%), Query Frame = 1
Query:  598 GARVLVVCSEITAVTFRGPADTHLDS 675
            GARVLVVCSEITAVTFRGP+++HLDS
Sbjct:  184 GARVLVVCSEITAVTFRGPSESHLDS 209          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS5_PEA (Chalcone synthase 5 OS=Pisum sativum GN=CHS5 PE=3 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.938e-96
Identity = 153/181 (84.53%), Postives = 168/181 (92.82%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YFRIT SEH TELK+KF+RMCDKSMI +RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFRITNSEHKTELKQKFQRMCDKSMINRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 1.938e-96
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS3_PEA (Chalcone synthase 3 OS=Pisum sativum GN=CHS3 PE=3 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.938e-96
Identity = 153/181 (84.53%), Postives = 168/181 (92.82%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YFRIT SEH TELK+KF+RMCDKSMI +RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFRITNSEHKTELKQKFQRMCDKSMINRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 1.938e-96
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS7_IPOBA (Chalcone synthase DIII OS=Ipomoea batatas GN=CHS-DIII PE=2 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 2.529e-96
Identity = 155/181 (85.64%), Postives = 167/181 (92.27%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E+R A+RA+GPAT+LAIGTATPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH+ FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVEEVRKAKRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVFFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 51.2174 bits (121), Expect = 2.529e-96
Identity = 22/27 (81.48%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVL+VCSEIT VTFRGP++THLDS
Sbjct:  182 KGARVLIVCSEITVVTFRGPSETHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS4_IPOBA (Chalcone synthase LF4 OS=Ipomoea batatas GN=CHS-LF4 PE=2 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 2.529e-96
Identity = 154/181 (85.08%), Postives = 167/181 (92.27%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E+R AQRA+GPAT+LAIGT TPA+ VNQ+ YPDYYFRIT SEH TELKE+F+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKERFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 51.2174 bits (121), Expect = 2.529e-96
Identity = 22/27 (81.48%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVL+VCSEIT VTFRGP++THLDS
Sbjct:  182 KGARVLIVCSEITVVTFRGPSETHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS9_MEDSA (Chalcone synthase 9 OS=Medicago sativa GN=CHS9 PE=2 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 3.299e-96
Identity = 152/181 (83.98%), Postives = 168/181 (92.82%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT++AIGTA PA+ V Q+ YPD+YF+IT SEH  ELKEKF+RMCDKSMIK+RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSEIRQAQRAEGPATIMAIGTANPANCVEQSTYPDFYFKITNSEHKVELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 3.299e-96
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS8_MEDSA (Chalcone synthase 8 OS=Medicago sativa GN=CHS8 PE=2 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 3.299e-96
Identity = 153/181 (84.53%), Postives = 168/181 (92.82%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH TELKEKF+RMCDKSMIK+RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSEIRTAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 3.299e-96
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS4_MEDSA (Chalcone synthase 4 OS=Medicago sativa GN=CHS4 PE=2 SV=2)

HSP 1 Score: 319.316 bits (817), Expect = 3.299e-96
Identity = 153/181 (84.53%), Postives = 168/181 (92.82%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH TELKEKF+RMCDKSMIK+RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 3.299e-96
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:  182 KGARVLVVCSEVTAVTFRGPSDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_ARAAL (Chalcone synthase OS=Arabis alpina GN=CHS PE=3 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 4.304e-96
Identity = 152/179 (84.92%), Postives = 166/179 (92.74%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            +++EIR AQRADGPA +L IGTA P + V QA+YPDYYFRIT S+HMT+LKEKFKRMCDKSMI+KR+M+LTEE LKENP MCAYMAPSLD RQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    4 SLEEIRKAQRADGPAGILGIGTANPPNHVLQAEYPDYYFRITNSDHMTDLKEKFKRMCDKSMIRKRHMHLTEEFLKENPKMCAYMAPSLDTRQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 182          

HSP 2 Score: 54.6842 bits (130), Expect = 4.304e-96
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:  183 RGARVLVVCSEITAVTFRGPSDTHLDS 209          
The following BLAST results are available for this feature:
BLAST of FC876218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS4_BROFI1.938e-9685.96Chalcone synthase 4 OS=Bromheadia finlaysoniana GN... [more]
CHS3_BROFI1.938e-9685.96Chalcone synthase 3 OS=Bromheadia finlaysoniana GN... [more]
CHS5_PEA1.938e-9684.53Chalcone synthase 5 OS=Pisum sativum GN=CHS5 PE=3 ... [more]
CHS3_PEA1.938e-9684.53Chalcone synthase 3 OS=Pisum sativum GN=CHS3 PE=3 ... [more]
CHS7_IPOBA2.529e-9685.64Chalcone synthase DIII OS=Ipomoea batatas GN=CHS-D... [more]
CHS4_IPOBA2.529e-9685.08Chalcone synthase LF4 OS=Ipomoea batatas GN=CHS-LF... [more]
CHS9_MEDSA3.299e-9683.98Chalcone synthase 9 OS=Medicago sativa GN=CHS9 PE=... [more]
CHS8_MEDSA3.299e-9684.53Chalcone synthase 8 OS=Medicago sativa GN=CHS8 PE=... [more]
CHS4_MEDSA3.299e-9684.53Chalcone synthase 4 OS=Medicago sativa GN=CHS4 PE=... [more]
CHSY_ARAAL4.304e-9684.92Chalcone synthase OS=Arabis alpina GN=CHS PE=3 SV=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H02EF DevOvary1 Citrus clementina cDNA clone C32001H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876218 ID=FC876218|Name=FC876218|organism=Citrus clementina|type=EST|length=675bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCT
back to top