FC876220

Overview
NameFC876220
Unique NameFC876220
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length716
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:8..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSD_PETHY (Chalcone synthase D OS=Petunia hybrida GN=CHSD PE=3 SV=2)

HSP 1 Score: 300.827 bits (769), Expect = 2.783e-97
Identity = 145/182 (79.67%), Postives = 165/182 (90.66%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV+E+RNAQRA+GPATVLAIGTATP++ V+Q+ YPDYYFRIT SEH TELKEKFKR+CDKSMIKKRY++LTE+ILKENPN+C  MAPSLDAR +I  VEVPKLGKEAA KAI+EW QPKS+ITHL+FCTT+GV MPGAD+QLTKL+GL  SVKRFMM Q GCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVEEVRNAQRAEGPATVLAIGTATPSNCVDQSTYPDYYFRITDSEHKTELKEKFKRICDKSMIKKRYMHLTEKILKENPNICESMAPSLDARTNIYAVEVPKLGKEAAEKAIEEWNQPKSRITHLVFCTTTGVSMPGADFQLTKLLGLGSSVKRFMMNQLGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 76.2554 bits (186), Expect = 2.783e-97
Identity = 37/41 (90.24%), Postives = 38/41 (92.68%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEIT VTFRGP DTH DSLVGQALFGDGAAAV
Sbjct:  182 KGARVLVVCSEITVVTFRGPNDTHFDSLVGQALFGDGAAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS1_DAUCA (Chalcone synthase 1 OS=Daucus carota GN=CHS1 PE=2 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 1.373e-96
Identity = 146/182 (80.22%), Postives = 163/182 (89.56%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV E R AQRA+GPATVLAIGTATP + V+Q+ Y DYYFRIT SE   ELKEKF+RMC+KSMI  RY++LTE++LK+NP+ C YMA SLDARQDIVV EVPKLGKEAA +AIKEWGQPKSKITHLIFCTTSGVDMPGAD++LTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVNEFRKAQRAEGPATVLAIGTATPPNCVDQSAYADYYFRITNSEDKPELKEKFRRMCEKSMINTRYMHLTEDLLKQNPSFCEYMASSLDARQDIVVNEVPKLGKEAALRAIKEWGQPKSKITHLIFCTTSGVDMPGADFRLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 73.559 bits (179), Expect = 1.373e-96
Identity = 35/41 (85.37%), Postives = 37/41 (90.24%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            + ARVLVVCSEIT +TFRGP DTHLDSLVGQALFGDGA AV
Sbjct:  182 KNARVLVVCSEITVITFRGPNDTHLDSLVGQALFGDGAGAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS9_DAUCA (Chalcone synthase 9 OS=Daucus carota GN=CHS9 PE=2 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 3.977e-96
Identity = 145/182 (79.67%), Postives = 163/182 (89.56%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV E R AQRA+GPATVLAIGTATP + V+Q+ Y DYYFRIT SE   ELKEKF+RMC+KSMI  RY++LTE++LK+NP+ C YMA SLDARQDIVV EVPKLGKEAA +AIKEWG+PKSKITHLIFCTTSGVDMPGAD++LTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVNEFRKAQRAEGPATVLAIGTATPPNCVDQSAYADYYFRITNSEDKPELKEKFRRMCEKSMINTRYMHLTEDLLKQNPSFCEYMASSLDARQDIVVNEVPKLGKEAALRAIKEWGRPKSKITHLIFCTTSGVDMPGADFRLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 73.559 bits (179), Expect = 3.977e-96
Identity = 35/41 (85.37%), Postives = 37/41 (90.24%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            + ARVLVVCSEIT +TFRGP DTHLDSLVGQALFGDGA AV
Sbjct:  182 KNARVLVVCSEITVITFRGPNDTHLDSLVGQALFGDGAGAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: THS2_VITVI (Stilbene synthase 2 OS=Vitis vinifera GN=GSVIVT00004047001 PE=2 SV=2)

HSP 1 Score: 297.36 bits (760), Expect = 2.799e-94
Identity = 140/181 (77.35%), Postives = 163/181 (90.06%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            MA+V+EIRNAQRA GPAT+LAIGTATP H V Q+DY DYYFR+TKSEHMT LK+KF R+CDKSMIKKRYI+LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVPKLGKEAA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL PSV+R M+Y QGC+AGGTVLR AKDLAENN
Sbjct:    1 MASVEEIRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTALKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLEPSVRRVMLYHQGCYAGGTVLRTAKDLAENN 181          

HSP 2 Score: 69.707 bits (169), Expect = 2.799e-94
Identity = 34/40 (85.00%), Postives = 37/40 (92.50%), Query Frame = 2
Query:  596 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            GARVLVVCSEIT VTFRGP++  LDSLVGQALFGDG+AAV
Sbjct:  183 GARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: THS5_VITVI (Stilbene synthase 5 OS=Vitis vinifera GN=GSVIVT00007357001 PE=3 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 1.058e-93
Identity = 139/181 (76.80%), Postives = 163/181 (90.06%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            MA+V+EIRNAQRA GPAT+LAIGTATP H V Q+DY DYYF++TKSEHMTELK+KF R+CDKSMIKKRYI+LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVPKLGKEAA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL  SV+R M+Y QGC+AGGTVLR AKDLAENN
Sbjct:    1 MASVEEIRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFKVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENN 181          

HSP 2 Score: 69.707 bits (169), Expect = 1.058e-93
Identity = 34/40 (85.00%), Postives = 37/40 (92.50%), Query Frame = 2
Query:  596 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            GARVLVVCSEIT VTFRGP++  LDSLVGQALFGDG+AAV
Sbjct:  183 GARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: THS4_VITVI (Stilbene synthase 4 OS=Vitis vinifera GN=GSVIVT00005194001 PE=3 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 1.800e-93
Identity = 139/181 (76.80%), Postives = 164/181 (90.61%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            MA+V+EIRNAQRA GPATVLAIGTATP + + Q+D+ DYYFR+TKSEHMTELK+KF R+CDKSMIKKRYI+LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVPKLGKEAA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL PSV+R M+Y QGC+AGGTVLR AKDLAENN
Sbjct:    1 MASVEEIRNAQRAKGPATVLAIGTATPDNCLYQSDFADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLEPSVRRVMLYHQGCYAGGTVLRTAKDLAENN 181          

HSP 2 Score: 69.707 bits (169), Expect = 1.800e-93
Identity = 34/40 (85.00%), Postives = 37/40 (92.50%), Query Frame = 2
Query:  596 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            GARVLVVCSEIT VTFRGP++  LDSLVGQALFGDG+AAV
Sbjct:  183 GARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSF_PETHY (Chalcone synthase F OS=Petunia hybrida GN=CHSF PE=2 SV=2)

HSP 1 Score: 293.893 bits (751), Expect = 1.510e-92
Identity = 139/182 (76.37%), Postives = 161/182 (88.46%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V+E+R AQR +GPAT+LAIGTATP + V+Q  YPDY+FR+T S+H TELKEKFKRM ++SMIKK Y++LTEEILKENP++C + APS DARQDIVVVEVPKLGKEAA  AIKEWGQPKSKITHL+FCTT+GVDM GADYQLTKL+GL PSVKR MMYQ GC+ GGTVLRLAKDLAENN+
Sbjct:    1 MVSVEEVRRAQRREGPATILAIGTATPLNCVDQTTYPDYFFRVTNSDHKTELKEKFKRMFERSMIKKSYLHLTEEILKENPSICEHKAPSFDARQDIVVVEVPKLGKEAAQNAIKEWGQPKSKITHLVFCTTTGVDMHGADYQLTKLLGLSPSVKRLMMYQLGCYGGGTVLRLAKDLAENNK 182          

HSP 2 Score: 67.3958 bits (163), Expect = 1.510e-92
Identity = 32/41 (78.05%), Postives = 36/41 (87.80%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GAR LVVCSEITA+TF  P+DT LD LVGQALFGDGAA+V
Sbjct:  182 KGARALVVCSEITAITFHAPSDTDLDVLVGQALFGDGAASV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_EQUAR (Chalcone synthase OS=Equisetum arvense GN=CHS PE=2 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 2.569e-92
Identity = 138/183 (75.41%), Postives = 154/183 (84.15%), Query Frame = 3
Query:   48 EMATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            E A     R AQRA+GPATVLAIGTA PA+   Q+ YPD+YF IT S+HMTELK KF RMC KS IKKRY++L  EILK NP++CAY   SLD RQDI VVEVPKLGKEA+ KAIKEWGQPKSKITHL+FCTTSGVDMPGAD+ LTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKD+AENN+
Sbjct:    6 ESADASSRRLAQRANGPATVLAIGTANPANVFEQSSYPDFYFDITNSQHMTELKLKFSRMCQKSGIKKRYMHLNSEILKANPSLCAYWEKSLDVRQDIAVVEVPKLGKEASLKAIKEWGQPKSKITHLVFCTTSGVDMPGADWALTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDVAENNK 188          

HSP 2 Score: 77.411 bits (189), Expect = 2.569e-92
Identity = 37/41 (90.24%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEIT VTFRGP++THLDSLVGQALFGDGAAAV
Sbjct:  188 KGARVLVVCSEITCVTFRGPSETHLDSLVGQALFGDGAAAV 228          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: VPS_HUMLU (Phloroisovalerophenone synthase OS=Humulus lupulus GN=VPS PE=2 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 3.352e-92
Identity = 136/180 (75.56%), Postives = 162/180 (90.00%), Query Frame = 3
Query:   57 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            TV++IR AQRA+GPAT+LAIGTA PA+  NQAD+PDYYFR+TKSEHMT+LK+KF+RMC+KS IKKRY++LTEE LK+NP++C Y APSL+ RQD++VVEVPKLGKEAA  AIKEWGQPKSKITHLIFCT S +DMPGADYQ  KL+GLRPSVKR M+YQ GC+AGG VLR+AKD+AENN+
Sbjct:    5 TVEQIRKAQRAEGPATILAIGTAVPANCFNQADFPDYYFRVTKSEHMTDLKKKFQRMCEKSTIKKRYLHLTEEHLKQNPHLCEYNAPSLNTRQDMLVVEVPKLGKEAAINAIKEWGQPKSKITHLIFCTGSSIDMPGADYQCAKLLGLRPSVKRVMLYQLGCYAGGKVLRIAKDIAENNK 184          

HSP 2 Score: 66.6254 bits (161), Expect = 3.352e-92
Identity = 30/41 (73.17%), Postives = 37/41 (90.24%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVL+VCSEITA  FRGP++ HLD LVGQ+LFGDGA++V
Sbjct:  184 KGARVLIVCSEITACIFRGPSEKHLDCLVGQSLFGDGASSV 224          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: THS7_VITVI (Stilbene synthase 6 OS=Vitis vinifera GN=STS PE=2 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 3.352e-92
Identity = 136/181 (75.14%), Postives = 162/181 (89.50%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            MA+V+E RNAQRA GPAT+LAIGTATP H V Q+DY DYYFR+TKSEHMTELK+KF R+CDKSMIKKRYI+LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVP+LG++AA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL  SV+R M+Y QGC+AGGTVLR AKDLAENN
Sbjct:    1 MASVEEFRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPRLGRDAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENN 181          

HSP 2 Score: 68.5514 bits (166), Expect = 3.352e-92
Identity = 33/40 (82.50%), Postives = 37/40 (92.50%), Query Frame = 2
Query:  596 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            GARVLVVCSEIT VTFRGP++  LDSLVGQALFGDG++AV
Sbjct:  183 GARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSSAV 222          
The following BLAST results are available for this feature:
BLAST of FC876220 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSD_PETHY2.783e-9779.67Chalcone synthase D OS=Petunia hybrida GN=CHSD PE=... [more]
CHS1_DAUCA1.373e-9680.22Chalcone synthase 1 OS=Daucus carota GN=CHS1 PE=2 ... [more]
CHS9_DAUCA3.977e-9679.67Chalcone synthase 9 OS=Daucus carota GN=CHS9 PE=2 ... [more]
THS2_VITVI2.799e-9477.35Stilbene synthase 2 OS=Vitis vinifera GN=GSVIVT000... [more]
THS5_VITVI1.058e-9376.80Stilbene synthase 5 OS=Vitis vinifera GN=GSVIVT000... [more]
THS4_VITVI1.800e-9376.80Stilbene synthase 4 OS=Vitis vinifera GN=GSVIVT000... [more]
CHSF_PETHY1.510e-9276.37Chalcone synthase F OS=Petunia hybrida GN=CHSF PE=... [more]
CHSY_EQUAR2.569e-9275.41Chalcone synthase OS=Equisetum arvense GN=CHS PE=2... [more]
VPS_HUMLU3.352e-9275.56Phloroisovalerophenone synthase OS=Humulus lupulus... [more]
THS7_VITVI3.352e-9275.14Stilbene synthase 6 OS=Vitis vinifera GN=STS PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H05EF DevOvary1 Citrus clementina cDNA clone C32001H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876220 ID=FC876220|Name=FC876220|organism=Citrus clementina|type=EST|length=716bp
AACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGAA
ATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGC
CACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAGG
CTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACG
GAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGAA
GCGTTACATATACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGT
GCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGGTC
GAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAATG
GGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCCG
GCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCTG
CGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCGG
CGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGCGC
TCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGGCC
CTGCCGATACTCATCTTGATTCTCTTGTGGGCCAGGCTTTGTTCGGTGAT
GGTGCTGCTGCTGTGA
back to top