FC876220

Overview
NameFC876220
Unique NameFC876220
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length716
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:8..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: THS1_VITVI (Stilbene synthase 1 OS=Vitis vinifera GN=VINST1 PE=1 SV=2)

HSP 1 Score: 291.582 bits (745), Expect = 3.352e-92
Identity = 136/181 (75.14%), Postives = 162/181 (89.50%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            MA+V+E RNAQRA GPAT+LAIGTATP H V Q+DY DYYFR+TKSEHMTELK+KF R+CDKSMIKKRYI+LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVP+LG++AA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL  SV+R M+Y QGC+AGGTVLR AKDLAENN
Sbjct:    1 MASVEEFRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPRLGRDAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENN 181          

HSP 2 Score: 68.5514 bits (166), Expect = 3.352e-92
Identity = 33/40 (82.50%), Postives = 37/40 (92.50%), Query Frame = 2
Query:  596 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            GARVLVVCSEIT VTFRGP++  LDSLVGQALFGDG++AV
Sbjct:  183 GARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSSAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: THS3_VITVI (Stilbene synthase 3 (Fragment) OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 2.812e-91
Identity = 136/178 (76.40%), Postives = 159/178 (89.33%), Query Frame = 3
Query:   60 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            V+EIRNAQRA GPAT+LAIGTATP H V Q+DY DYYFR+TKSE M+ELK+KF R+CDKSMIKKRYI+LTEE+L+E+PN+ AYMAPSL+ RQ+I+  EVPKLGKEAA KA+KEWGQPKSKITHL+FCTTSGV+MPGADY+L  L+GL  SV+R M+Y QGC+AGGTVLR AKDLAENN
Sbjct:    1 VEEIRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEPMSELKKKFNRICDKSMIKKRYIHLTEEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTSGVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENN 178          

HSP 2 Score: 69.707 bits (169), Expect = 2.812e-91
Identity = 34/40 (85.00%), Postives = 37/40 (92.50%), Query Frame = 2
Query:  596 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            GARVLVVCSEIT VTFRGP++  LDSLVGQALFGDG+AAV
Sbjct:  180 GARVLVVCSEITVVTFRGPSEDALDSLVGQALFGDGSAAV 219          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS2_HORVU (Chalcone synthase 2 OS=Hordeum vulgare GN=CHS2 PE=2 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 5.235e-90
Identity = 136/179 (75.98%), Postives = 158/179 (88.27%), Query Frame = 3
Query:   60 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            ++E+R AQRA+G ATVLAIGTA PA+ V QA YPDYYFR+TKSEH+ +LKEKF+RMCDKSMI+KR+++LTEEIL +NP +CA+M  SLDAR  I +VEVPKLG+ AA KAIKEWGQP SKITHL+FCTTSGVDMPGADYQLTKL+GL P+VKR MMYQQGCF G TVLRLAKD+AENNR
Sbjct:    6 LKEVRMAQRAEGLATVLAIGTAVPANCVYQATYPDYYFRVTKSEHLADLKEKFQRMCDKSMIRKRHMHLTEEILIKNPKICAHMETSLDARHAIALVEVPKLGQGAAEKAIKEWGQPLSKITHLVFCTTSGVDMPGADYQLTKLLGLSPTVKRLMMYQQGCFGGATVLRLAKDIAENNR 184          

HSP 2 Score: 69.3218 bits (168), Expect = 5.235e-90
Identity = 33/40 (82.50%), Postives = 36/40 (90.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAA 712
            +GARVLVVCSEITA+ FRGP  +HLDSLVG ALFGDGAAA
Sbjct:  184 RGARVLVVCSEITAMAFRGPCKSHLDSLVGHALFGDGAAA 223          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: THS3_ARAHY (Stilbene synthase 3 OS=Arachis hypogaea PE=2 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 2.580e-89
Identity = 132/182 (72.53%), Postives = 159/182 (87.36%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V  IR  QRA+GPATVLAIGTA P + ++Q+ Y DYYFR+T SEHMT+LK+KF+R+C+++ IK R++YLTEEILKENPNMCAY APSLDAR+D+++ EVP++GKEAATKAIKEWGQP SKITHLIFCTTSGV +PG DY+L  L+GL P VKR+MMY QGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVSGIRKVQRAEGPATVLAIGTANPPNCIDQSTYADYYFRVTNSEHMTDLKKKFQRICERTQIKNRHMYLTEEILKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGVDYELIVLLGLDPCVKRYMMYHQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 66.2402 bits (160), Expect = 2.580e-89
Identity = 31/39 (79.49%), Postives = 36/39 (92.31%), Query Frame = 2
Query:  599 ARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            ARVL+VCSE TAVTFRGP++T +DSLVGQALF DGAAA+
Sbjct:  184 ARVLIVCSENTAVTFRGPSETDMDSLVGQALFADGAAAI 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: THS1_ARAHY (Stilbene synthase 1 OS=Arachis hypogaea PE=2 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 3.365e-89
Identity = 133/182 (73.08%), Postives = 159/182 (87.36%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +V  IR  QRA+GPATVLAIGTA P + V+Q+ Y DYYFR+T  EHMT+LK+KF+R+C+++ IK R++YLTEEILKENPNMCAY APSLDAR+D+++ EVP++GKEAATKAIKEWGQP SKITHLIFCTTSGV +PG DY+L  L+GL PSVKR+MMY QGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVSGIRKVQRAEGPATVLAIGTANPPNCVDQSTYADYYFRVTNGEHMTDLKKKFQRICERTQIKNRHMYLTEEILKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGVDYELIVLLGLDPSVKRYMMYHQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 65.0846 bits (157), Expect = 3.365e-89
Identity = 31/39 (79.49%), Postives = 35/39 (89.74%), Query Frame = 2
Query:  599 ARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            ARVL+VCSE TAVTFRGP +T +DSLVGQALF DGAAA+
Sbjct:  184 ARVLIVCSENTAVTFRGPNETDMDSLVGQALFADGAAAI 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: 2PS_GERHY (2-pyrone synthase OS=Gerbera hybrida GN=2PS PE=1 SV=2)

HSP 1 Score: 281.952 bits (720), Expect = 1.271e-88
Identity = 136/179 (75.98%), Postives = 155/179 (86.59%), Query Frame = 3
Query:   60 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            V+ IR A RA G AT+LAIGTATP + V QADY DYYFR+TKSEHM +LKEKFKR+C+K+ IKKRY+ LTE+ L+ENP MC +MAPSL+ARQD+VV  VP LGKEAA KAI EWG PKSKITHLIFCTT+GVDMPGADYQL KL+GL PSVKR+M+YQQGC AGGTVLRLAKDLAENN+
Sbjct:    9 VEVIREAGRAQGLATILAIGTATPPNCVAQADYADYYFRVTKSEHMVDLKEKFKRICEKTAIKKRYLALTEDYLQENPTMCEFMAPSLNARQDLVVTGVPMLGKEAAVKAIDEWGLPKSKITHLIFCTTAGVDMPGADYQLVKLLGLSPSVKRYMLYQQGCAAGGTVLRLAKDLAENNK 187          

HSP 2 Score: 66.2402 bits (160), Expect = 1.271e-88
Identity = 30/41 (73.17%), Postives = 36/41 (87.80%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +G+RVL+VCSEITA+ F GP + HLDSLV QALFGDGAAA+
Sbjct:  187 KGSRVLIVCSEITAILFHGPNENHLDSLVAQALFGDGAAAL 227          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: ACS2_RUTGR (Acridone synthase 2 OS=Ruta graveolens GN=ACS2 PE=1 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.166e-86
Identity = 128/182 (70.33%), Postives = 159/182 (87.36%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +++E+R AQ+++GPA +LAIGTATP +   QADYPDYYF+ITKSEHMTELK+KFK +C+KSMI+KR++  ++E LK NP +C +M  SL+ARQDI VVE P++GKEAA KAIKEWG PKS ITHLIFCT++GVDMPGADYQLT+++GL PSVKR M+YQQGC+AGGTVLRLAKDLAENN+
Sbjct:    1 MESLKEMRKAQKSEGPAAILAIGTATPDNVYIQADYPDYYFKITKSEHMTELKDKFKTLCEKSMIRKRHMCFSQEFLKANPEVCKHMGKSLNARQDIAVVETPRIGKEAAVKAIKEWGHPKSSITHLIFCTSAGVDMPGADYQLTRMLGLNPSVKRMMIYQQGCYAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 62.7734 bits (151), Expect = 1.166e-86
Identity = 30/41 (73.17%), Postives = 36/41 (87.80%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +G+RVLVVCSE+TA TFRGP+   +DSLVGQALF DGAAA+
Sbjct:  182 KGSRVLVVCSELTAPTFRGPSPDAVDSLVGQALFADGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: ACS3_RUTGR (Probable acridone synthase 3 OS=Ruta graveolens GN=ACS3 PE=2 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 2.829e-85
Identity = 126/182 (69.23%), Postives = 157/182 (86.26%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +++E+R AQ ++GPA +LAIGTA P +   QADYPDYYF++TKSEHMTELK+KF+ +C+KSMI+KR++  +EE LK NP +C +M  SL+ARQDI VVE P+LG EAA KAIKEWGQPKS ITHLIFC+++GVDMPGADYQLT+++GL PSVKR M+YQQGC+AGGTVLRLAKDLAENN+
Sbjct:    1 MESLKEMRKAQMSEGPAAILAIGTANPDNVYMQADYPDYYFKMTKSEHMTELKDKFRTLCEKSMIRKRHMCFSEEFLKANPEVCKHMGKSLNARQDIAVVETPRLGNEAAVKAIKEWGQPKSSITHLIFCSSAGVDMPGADYQLTRILGLNPSVKRMMIYQQGCYAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 62.7734 bits (151), Expect = 2.829e-85
Identity = 30/41 (73.17%), Postives = 36/41 (87.80%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +G+RVLVVCSE+TA TFRGP+   +DSLVGQALF DGAAA+
Sbjct:  182 KGSRVLVVCSELTAPTFRGPSPDAVDSLVGQALFADGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: ACS4_RUTGR (Probable acridone synthase 4 OS=Ruta graveolens GN=ACS4 PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 4.814e-85
Identity = 127/182 (69.78%), Postives = 157/182 (86.26%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M +++E+R AQ ++GPA +LAIGTATP +   QADYPDYYFR+TKSEHMTELK+KF+ +C+KSMI+KR++  +EE LK NP +  +M  SL+ARQDI VVE P+LG EAA KAIKEWGQPKS ITHLIFC+++GVDMPGADYQLT+++GL PSVKR M+YQQGC+AGGTVLRLAKDLAENN+
Sbjct:    1 MESLKEMRKAQMSEGPAAILAIGTATPNNVYMQADYPDYYFRMTKSEHMTELKDKFRTLCEKSMIRKRHMCFSEEFLKANPEVSKHMGKSLNARQDIAVVETPRLGNEAAVKAIKEWGQPKSSITHLIFCSSAGVDMPGADYQLTRILGLNPSVKRMMVYQQGCYAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 62.7734 bits (151), Expect = 4.814e-85
Identity = 30/41 (73.17%), Postives = 36/41 (87.80%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +G+RVLVVCSE+TA TFRGP+   +DSLVGQALF DGAAA+
Sbjct:  182 KGSRVLVVCSELTAPTFRGPSPDAVDSLVGQALFADGAAAL 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSG_PETHY (Chalcone synthase G OS=Petunia hybrida GN=CHSG PE=2 SV=2)

HSP 1 Score: 283.878 bits (725), Expect = 8.191e-85
Identity = 135/182 (74.18%), Postives = 158/182 (86.81%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            MATV+EIR AQRA+GPATVLAIGTA P++ V+Q+ YPD+ FRIT S+H TELKEKFK MC+ SMIKKRY++LTEEILK NPN+C + APSL+ARQ+I V E PKLGK AA KAI+EW Q KSKITHL+FCTT+ V++PGADYQLTKL+GL PSVKR MMYQQGC+ GGT LRLAKDLAENN+
Sbjct:    1 MATVEEIRKAQRAEGPATVLAIGTANPSNCVDQSAYPDFLFRITTSDHKTELKEKFKHMCEGSMIKKRYLHLTEEILKNNPNICEHKAPSLNARQEIAVAEAPKLGKRAAQKAIEEWSQSKSKITHLVFCTTTSVELPGADYQLTKLLGLSPSVKRSMMYQQGCYGGGTALRLAKDLAENNK 182          

HSP 2 Score: 51.6026 bits (122), Expect = 8.191e-85
Identity = 29/44 (65.91%), Postives = 35/44 (79.55%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPA--DT-HLDSLVGQALFGDGAAAV 715
            +GARVLVVC EIT ++F+ P+  DT  LD LVGQALF DGA+AV
Sbjct:  182 KGARVLVVCVEITVMSFQAPSRNDTDELDVLVGQALFADGASAV 225          
The following BLAST results are available for this feature:
BLAST of FC876220 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
THS1_VITVI3.352e-9275.14Stilbene synthase 1 OS=Vitis vinifera GN=VINST1 PE... [more]
THS3_VITVI2.812e-9176.40Stilbene synthase 3 (Fragment) OS=Vitis vinifera P... [more]
CHS2_HORVU5.235e-9075.98Chalcone synthase 2 OS=Hordeum vulgare GN=CHS2 PE=... [more]
THS3_ARAHY2.580e-8972.53Stilbene synthase 3 OS=Arachis hypogaea PE=2 SV=1[more]
THS1_ARAHY3.365e-8973.08Stilbene synthase 1 OS=Arachis hypogaea PE=2 SV=1[more]
2PS_GERHY1.271e-8875.982-pyrone synthase OS=Gerbera hybrida GN=2PS PE=1 S... [more]
ACS2_RUTGR1.166e-8670.33Acridone synthase 2 OS=Ruta graveolens GN=ACS2 PE=... [more]
ACS3_RUTGR2.829e-8569.23Probable acridone synthase 3 OS=Ruta graveolens GN... [more]
ACS4_RUTGR4.814e-8569.78Probable acridone synthase 4 OS=Ruta graveolens GN... [more]
CHSG_PETHY8.191e-8574.18Chalcone synthase G OS=Petunia hybrida GN=CHSG PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H05EF DevOvary1 Citrus clementina cDNA clone C32001H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876220 ID=FC876220|Name=FC876220|organism=Citrus clementina|type=EST|length=716bp
AACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGAA
ATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGC
CACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAGG
CTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACG
GAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGAA
GCGTTACATATACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGT
GCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGGTC
GAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAATG
GGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCCG
GCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCTG
CGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCGG
CGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGCGC
TCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGGCC
CTGCCGATACTCATCTTGATTCTCTTGTGGGCCAGGCTTTGTTCGGTGAT
GGTGCTGCTGCTGTGA
back to top